Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00852
Secondary Accession Numbers None
Name Glutamine-dependent NAD(+) synthetase
Synonyms Not Available
Gene Name NADSYN1
Protein Type Enzyme
Biological Properties
General Function Coenzyme transport and metabolism
Specific Function Catalyzes the ATP-dependent amidation of deamido-NAD to form NAD. Uses L-glutamine as a nitrogen source.
Pathways
  • Cofactor biosynthesis
  • Glutamate Metabolism
  • NAD(+) biosynthesis
  • NAD(+) from deamido-NAD(+) (L-Gln route): step 1/1
  • Nicotinate and Nicotinamide Metabolism
Reactions
Nicotinic acid adenine dinucleotide + Adenosine triphosphate + Water + L-Glutamine → NAD + Adenosine monophosphate + Pyrophosphate + L-Glutamic acid details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 29
Locus Not Available
SNPs NADSYN1
Gene Sequence
>2121 bp
ATGGGGCGAAAGGTGACCGTGGCCACCTGTGCGCTCAACCAGTGGGCCCTGGACTTTGAG
GGCAATTTGCAAAGGATTTTAAAAAGTATTGAAATTGCCAAACACAGAGGAGCAAGATAC
AGGCTTGGACCAGAACTGGAAATCTGTGGCTACGGCTGTTGGGATCATTATTACGAGTCG
GACACCCTCCTGCATTCGCTCCAGGTCCTGGCGGCCCTTTTGGAGTCTCCGGTCACTCAG
GATATCATCTGCGACGTGGGGATGCCCGTGATGCACCGAAACGTCCGCTATAACTGCAGG
GTGATATTCCTCAACAGGAAGATCCTGCTCATCAGACCCAAGATGGCCTTGGCGAATGAG
GGCAACTACCGAGAGTTGCGCTGGTTCACGCCATGGTCCAGGAGCCGGCAAACAGAGGAG
TATTTTCTCCCCCGGATGTTACAGGACCTGACGAAGCAGGAAACTGTGCCCTTTGGGGAT
GCCGTCCTCTCCACATGGGACACCTGTATCGGGAGTGAGGTCTGTGAGGAGCTCTGGACG
CCCCACAGCCCACACGTGGACATGGGCCTGGACGGCGTGGAGATCTTCACCAACGCCTCG
GGTAGCCATCACGTGCTGCGCAAAGCCCACGCCCGGGTGGACCTGGTGACCATGGCTACC
ACCAAGAACGGCGGGATCTACTTGCTGGCCAATCAGAAGGGCTGCGATGGGGACCGGCTG
TATTACGACGGCTGTGCTCTCATAGCCATGAACGGCAGCATCTTTGCCCAGGGGTCCCAG
TTCTCTCTGGATGACGTGGAAGTGCTCACTGCCACGTTGGATTTGGAGGACATCAGAAGC
TACAGGGCGGAGATTTCATCTCGAAACCTGGCGGCCAGCAGGGTGAGCCCCTACCCCCGC
GTGAAGGTGGATTTCGCCCTCTCCTGCCATGAAGACCTGCTGGAGCCTGTGTCTGAGCCT
ATCGAGTGGAAATACCACAGTCCCGCCGAGGAGATCAGCCTGGGACCCGCGTGCTGGCTC
TGGGACTTCTTAAGACGCAGCCGACAGGCAGGGTTCTTCCTTCCCCTGAGCGGCGGGGTG
GACAGCGCGGCCACCGCCTGCCTGGTCTACTCCATGTGCCACCAGGTCTGCGAGGCTGTG
AAGCGTGGAAATCTGGAGGTGCTGGCTGATGTCCGAACCATCGTGAACCAGCTCAGCTAC
ACCCCCCAGGACCCCCGGGAGCTCTGCGGCCGCGTCCTGACCACCTGCTACATGGCCAGC
GAGAACTCCTCCCAGGAGACCTGCGACAGGGCCCGAGAGCTGGCCCAGCAGATTGGAAGC
CACCACATCGGTCTCCACATCGACCCAGTGGTCAAGGCCCTCGTGGGCCTCTTCAGCCTG
GTGACGGGTGCGAGCCCTCGGTTTGCGGTTCACGGAGGGAGCGACCGGGAGAACCTGGCT
CTGCAGAACGTCCAGGCGCGGGTGAGGATGGTCATCGCCTACCTCTTCGCTCAGCTGAGC
CTCTGGTCTCGCGGTGCCCCCGGCGGGCTTCTCGTGCTCGGATCCGCCAATGTGGACGAG
AGCCTCCTTGGCTACCTGACCAAGTACGACTGCTCCAGCGCTGACATCAACCCCATCGGC
GGGATCAGCAAGACGGACCTGAGAGCCTTCGTCCAGCTCTGCGTGGAGCGCTTCCAGCTT
CCTGCCCTGCAGAGCATCCTGGCAGCACCGGCCACAGCTGAGCTGGAGCCCCTGGCCCAC
GGACGGGTGTCCCAGACCGATGAGGAAGACATGGGGATGACATATGCGGAGCTGTCCGTC
TACGGGAGGCTCCGGAAGGTCGCCAAGACAGGCCCCTACAGCATGTTCTGCAAACTCCTC
GACATGTGGAGGGATACCTGCTCGCCCCGACAGGTGGCTGACAAAGTGAAGTGCTTTTTC
TCCAAGTATTCCATGAACAGACACAAGATGACCACACTGACCCCCGCATACCACGCCGAG
AGCTACAGCCCGGACGACAACAGGTTCGACCTGCGGCCATTTCTGTATAACACCCGCTGG
CCCTGGCAGTTCCGCTGCATCGAAAACCAGGTCCTCCAGCTGGAGGGGAGACAGCGGCAG
GAGCTAGACGGCGTGGACTGA
Protein Properties
Number of Residues 706
Molecular Weight 79400.0
Theoretical pI 6.46
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Glutamine-dependent NAD(+) synthetase
MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKHRGARYRLGPELEICGYGCWDHYYES
DTLLHSLQVLAALLESPVTQDIICDVGMPVMHRNVRYNCRVIFLNRKILLIRPKMALANE
GNYRELRWFTPWSRSRQTEEYFLPRMLQDLTKQETVPFGDAVLSTWDTCIGSEVCEELWT
PHSPHVDMGLDGVEIFTNASGSHHVLRKAHARVDLVTMATTKNGGIYLLANQKGCDGDRL
YYDGCALIAMNGSIFAQGSQFSLDDVEVLTATLDLEDIRSYRAEISSRNLAASRVSPYPR
VKVDFALSCHEDLLEPVSEPIEWKYHSPAEEISLGPACWLWDFLRRSRQAGFFLPLSGGV
DSAATACLVYSMCHQVCEAVKRGNLEVLADVRTIVNQLSYTPQDPRELCGRVLTTCYMAS
ENSSQETCDRARELAQQIGSHHIGLHIDPVVKALVGLFSLVTGASPRFAVHGGSDRENLA
LQNVQARVRMVIAYLFAQLSLWSRGAPGGLLVLGSANVDESLLGYLTKYDCSSADINPIG
GISKTDLRAFVQLCVERFQLPALQSILAAPATAELEPLAHGRVSQTDEEDMGMTYAELSV
YGRLRKVAKTGPYSMFCKLLDMWRDTCSPRQVADKVKCFFSKYSMNRHKMTTLTPAYHAE
SYSPDDNRFDLRPFLYNTRWPWQFRCIENQVLQLEGRQRQELDGVD
GenBank ID Protein AAI03389.1
UniProtKB/Swiss-Prot ID Q3ZBF0
UniProtKB/Swiss-Prot Entry Name NADE_BOVIN
PDB IDs Not Available
GenBank Gene ID BC103388
GeneCard ID NADSYN1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available