Showing Protein Coagulation factor XIII A chain (BMDBP00854)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00854 |
| Secondary Accession Numbers | None |
| Name | Coagulation factor XIII A chain |
| Synonyms | Not Available |
| Gene Name | F13A1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in acyltransferase activity |
| Specific Function | Factor XIII is activated by thrombin and calcium ion to a transglutaminase that catalyzes the formation of gamma-glutamyl-epsilon-lysine cross-links between fibrin chains, thus stabilizing the fibrin clot. Also cross-link alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 23 |
| Locus | Not Available |
| SNPs | F13A1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 198 |
| Molecular Weight | 22745.0 |
| Theoretical pI | 6.27 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Coagulation factor XIII A chain MSESSGTAFGGRRAIPPNTSNAAENDPPTVELQGLVPRGFNPQDYLNVTNVHLFKERWDS NKVDHHTDKYSNDKLIVRRGQSFYIQIDFNRPYDPTRDLFRVEYVIGLYPQENKGTYIPV PLVSELQSGKWGAKVVMREDRSVRLSVQSSADCIVGKFRMYVAVWTPYGVIRTSRNPETD TYILFNPWCEEDAVYLEN |
| External Links | |
| GenBank ID Protein | ABF57306.1 |
| UniProtKB/Swiss-Prot ID | P12260 |
| UniProtKB/Swiss-Prot Entry Name | F13A_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | BT025350 |
| GeneCard ID | F13A1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |