Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00857
Secondary Accession Numbers None
Name 5-oxoprolinase
Synonyms Not Available
Gene Name OPLAH
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Catalyzes the cleavage of 5-oxo-L-proline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate.
Pathways
  • Glutathione Metabolism
Reactions
Adenosine triphosphate + Pyroglutamic acid + 2 Water → ADP + Hydrogen phosphate + L-Glutamic acid details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 14
Locus Not Available
SNPs OPLAH
Gene Sequence
>3867 bp
ATGGGTGGCCCGGAGGGCCGCTTCCATTTTGCCATCGACCGTGGAGGCACCTTCACAGAT
GTCTTTGCCCAGTGCCCAGGGGGGCACGTGAGGGTCCTAAAGCTGCTTTCAGAAGACCCT
GCCAACTATGTAGACGCCCCCACTGAAGGCATCCGCCGCATCCTGGAGCAGGAGGGGGGC
GTGCTGCTGCCGCGGGACCGGCCCCTGGACACCAGTCGCATCGCCAGCATCCGCATGGGC
ACCACGGTGGCGACCAATGCGCTGTTGGAACAACAGGGAGAGCGGGTGGCACTGCTGGTG
ACGCGCGGGTTCCGAGACCTGCTGCACGTGTGCACCCAGGCCCGCGCGGANCTCTTTGAC
CTGGCCGTGCCCATGCCCGAGACGCTGTACGAGGAGGTGCTGGAAGTGGACGAACGGGTG
GTGCTCTATCGAGGGGANCCGGGTGCTGGGACACCCGTGAAAGGCTGCACAGGGGACCTA
CTGGAAGTGCAGCAGCCTGTGGACCTGGGGGGCCTGCGATGGAAGCTGGAAGGTCTCCTG
TCCCGGGGCATCCGTAGCTTGGCCGTGGTGCTCATGCACTCGTACACGTGGGCCCAGCAC
GAGCAGCAGGTGGGCGCCCTGGCCCGGGAACTGGGCTTCACGCATGTGTCGCTGTCCTCG
GAGGCCATGCCCATGGTGCGCATTGTGCCCCGGGGGCACACGGCCTGTGCTGACGCCTAT
CTCACGCCCACCATCCAGCGCTACGTGCAGGGCTTCCGACGTGGCTTCCAGGGTCAGCTC
AAGGACGTGCAGGTGCTGTTCATGCGCTCCGACGGTGGGCTGGCGCCCATGGACTCCTTC
AGCGGCTCCCGCGCTGTGCTCTCCGGGCCTGCGGGGGGCGTGGTTGGTTACTCAGCCACC
ACCTACCGGGTGGAGGGCGGCCAGCCAGTCATCGGCTTTGACATGGGAGGCACGTCTACC
GACGTGAGCCGCTATGCTGGCGAGTTTGAGCATGTTTTCGAGGCCAGCACGGCTGGTGTC
ACCCTCCAGGCCCCCCAGCTGGATATCAACACTGTGGCAGCCGGTGGGGGCTCCCGCCTC
TTTTTCAGGTCGGGCCTCTTCGTGGTGGGGCCAGAGTCTGCGGGAGCCCACCCTGGCCCC
GCCTGCTACCGAAAAGGGGGCCCTGTGACAGTGACGGATGCTAATCTGGTCCTGGGTCGC
CTGCTGCCTGCCTCCTTCCCCTGCATTTTTGGGCCGGGAGAGGACCAGCCACTGTCCCCG
GAGGCGTCCCGAAAGGCCCTGGAGGCTGTGGCCACGGAGGTCAACAGCTTCCTGACCAAT
GGGCCTTGCCCGGCCTCCCCGCTGAGCCTGGAGGAGGTGGCCATGGGGTTTGTGCGTGTG
GCCAACGAGGCCATGTGTCGGCCCATCCGTGCACTCACGCAGGCACGAGGTCATGACCCC
TCGGCCCACGTGCTGGCCTGCTTTGGGGGAGCTGGTGGGCAGCATGCTTGTGCCATTGCC
CGGGCCCTGGGCATGGACACTGTGCACATTCACAGGCACAGTGGGCTGCTGTCGGCGCTG
GGGCTGGCCCTGGCTGATGTGGTGCATGAGGCGCAGGAGCCCTGCTCCCTGCCATATGCT
CCCGAGACCTTTGCGCAGCTGGACCAGAGGCTGGGCCGCCTGGAGGAGCAGTGTGTGGAG
GCCCTGCGGGCCCAGGGCTTCCCCAGGTCCCAGATCAGCACCGAGAGCTTCCTGCACCTG
CGCTACCAGGGCACGGACTGCGCCCTGATGGTGTCTGCCCACCAGCACCCGGCCAGTGCC
CGCTCACCCCGAGCTGGTGACTTTGGGGCAGCCTTTGTGGAGAGGTACATGAGGGAGTTC
GGCTTCATTATTCCCGAGCGGCCGGTGGTGGTGGATGACGTGCGGGTCAGGGGCACCGGC
AGCAGCAGCCTTCGCCTCGAGGACGTCCCAAAAGCCCATAGTGGGCCTCCCCGGGTAGAT
AAGATGACCCAGTGCTACTTTGAGGGGGGCTACCAGGAGACCCCTGTGTACCTGTTGGGA
GAGCTGGGCTGTGGGCACAAGCTTCAGGGGCCCTGCCTCATCATTGACAGCAACAGTACC
ATCCTGGTGGAGCCAGGCTGCCAGGCAGAGGTGACTGAGACTGGGGACATCCGCATCTCT
GTGGGGGCTGAGACAGCCAGCGTGGTGGGCACGCAGCTTGACCCCATCCACCTTACCATC
TTCTCCCACCGCTTCATGAGCATTGCTGAGCAGATGGGCCGCATCCTGCAGCGCACGGCC
ATCTCCACCAACATCAAGGAGCGTCTGGACTTCTCCTGCGCCCTCTTTGGGCCCGACGGG
GGGCTGGTCTCCAACGTCCCTCACATCCCTGTGCACCTGGGTGCCATGCAGGAGACGGTG
CAGTTCCAGATTCAGCAGTTGGGGGCTGATCTCCACCCCGGCGATGTGCTGCTGAGCAAC
CACCCCAGCGCGGGGGGCAGCCACTTGCCAGACCTGACTGTCATCACACCGGTGTTTTGG
CCGGGTCAGACACGGCCTGTGTTCTATGTGGCCAGCCGTGGGCACCATGCAGACATTGGG
GGCATCACACCAGGCTCCATGCCCCCCCACTCCACCAGCCTGCAGCAGGAGGGCGCGGTC
TTCCTTTCCTTCAAACTTGTGCATGGGGGAGTCTTCCAGGAAGAGGCGGTGACTGAAGCC
CTGCGGGCGCCAGGCAAGATCCCAGGCTGCAGCGGGACACGGAACCTGCACGACAACCTG
TCGGATCTGCGCGCCCAGGTGGCGGCCAACCAGAAGGGCATCCAGCTGGTGGGCGAGCTC
ATCGGGCAGTACGGCCTGGACGTGGTGCAGGCCTACATGGGCCACATTCAGGCAAACGCG
GAGCTCGCTGTGAGGGACATGCTCCGGGCCTTTGGAACTGCCCGGCAGGCCCGGGGCCTG
CCCCTGGAGGTGTCTGCAGAGGACCACATGGACGACGGTTCCCCTATCCGACTCCGAGTG
CAGATCAACATGAGTCAGGGTAGCGCGGTGTTTGATTTCAGCGGCTCAGGGCCAGAGGTG
TTCGGCAACCTCAACGCGCCGCGGGCCATCACGCTGTCTGCGCTCATCTACTGTCTTCGC
TGTCTGGTTGGCCGCGACATCCCACTCAACCAGGGCTGCCTGGCTCCGGTGCGCGTGGTG
ATTCCTAAAGGCTCCATCCTAGACCCTTCCCCCGACGCGGCCGTGGTGGGCGGCAACGTG
CTCACGTCGCAGCGCGTGGTGGACGTCATCCTGGGGGCCTTCGGGGCCTGCGCCGCTTCC
CAGGGCTGCATGAACAACGTGACCTTGGGCAACGCCCACATGGGCTACTACGAGACGGTG
GCGGGCGGTGCGGGCGCGGGACCGGGTTGGCACGGGCGCAGCGGCGTGCACAGCCACATG
ACCAACACGCGCATCACCGACCCCGAGATCCTGGAGAGCAGGTACCCGGTTATCCTGCGC
CGCTTCGAGCTAAGGCTGGGGTCCGGGGGTCGCGGCCGCTTCCGGGGCGGCGATGGCATT
ATCCGTGAGCTGCTTTTCCGCGAGGAGGCGCTGCTGTCCGTGCTGACTGAGCGCCGCGCC
TTCCAGCCGTATGGCCTGATGGGGGGTGAGCCTGGTGCCCGGGGCCTAAACCTACTCATC
CGGAAGGACGGCCGGACAGTAAACCTGGGTGGGAAGACCTCGGTGCCCGTGTACCCCGGG
GACGTGTTCTGTCTGCACACACCAGGCGGTGGGGGCTACGGGGACCCGGGAGACCCCGCC
CCACTGCCAGGTTCGCCCTTGCAGCCCCTAGCCTTCCCGGAGAGGGGCAGCGTGTATGAG
TACCGCAGGGCCCAGGAGGCTGTGTGA
Protein Properties
Number of Residues 1288
Molecular Weight 137450.0
Theoretical pI 6.55
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>5-oxoprolinase
MGGPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYVDAPTEGIRRILEQEGG
VLLPRDRPLDTSRIASIRMGTTVATNALLEQQGERVALLVTRGFRDLLHVCTQARAXLFD
LAVPMPETLYEEVLEVDERVVLYRGXPGAGTPVKGCTGDLLEVQQPVDLGGLRWKLEGLL
SRGIRSLAVVLMHSYTWAQHEQQVGALARELGFTHVSLSSEAMPMVRIVPRGHTACADAY
LTPTIQRYVQGFRRGFQGQLKDVQVLFMRSDGGLAPMDSFSGSRAVLSGPAGGVVGYSAT
TYRVEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRL
FFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGEDQPLSP
EASRKALEAVATEVNSFLTNGPCPASPLSLEEVAMGFVRVANEAMCRPIRALTQARGHDP
SAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLPYA
PETFAQLDQRLGRLEEQCVEALRAQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPASA
RSPRAGDFGAAFVERYMREFGFIIPERPVVVDDVRVRGTGSSSLRLEDVPKAHSGPPRVD
KMTQCYFEGGYQETPVYLLGELGCGHKLQGPCLIIDSNSTILVEPGCQAEVTETGDIRIS
VGAETASVVGTQLDPIHLTIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDG
GLVSNVPHIPVHLGAMQETVQFQIQQLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFW
PGQTRPVFYVASRGHHADIGGITPGSMPPHSTSLQQEGAVFLSFKLVHGGVFQEEAVTEA
LRAPGKIPGCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANA
ELAVRDMLRAFGTARQARGLPLEVSAEDHMDDGSPIRLRVQINMSQGSAVFDFSGSGPEV
FGNLNAPRAITLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPKGSILDPSPDAAVVGGNV
LTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPGWHGRSGVHSHM
TNTRITDPEILESRYPVILRRFELRLGSGGRGRFRGGDGIIRELLFREEALLSVLTERRA
FQPYGLMGGEPGARGLNLLIRKDGRTVNLGGKTSVPVYPGDVFCLHTPGGGGYGDPGDPA
PLPGSPLQPLAFPERGSVYEYRRAQEAV
GenBank ID Protein BAD13433.1
UniProtKB/Swiss-Prot ID Q75WB5
UniProtKB/Swiss-Prot Entry Name OPLA_BOVIN
PDB IDs Not Available
GenBank Gene ID AB121737
GeneCard ID OPLAH
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available