Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00878
Secondary Accession Numbers None
Name NADPH:adrenodoxin oxidoreductase, mitochondrial
Synonyms Not Available
Gene Name FDXR
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Serves as the first electron transfer protein in all the mitochondrial P450 systems including cholesterol side chain cleavage in all steroidogenic tissues, steroid 11-beta hydroxylation in the adrenal cortex, 25-OH-vitamin D3-24 hydroxylation in the kidney, and sterol C-27 hydroxylation in the liver.
Pathways
  • Cholesterol metabolism
  • Steroid metabolism
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus Not Available
SNPs FDXR
Gene Sequence
>1479 bp
GGGCTGGTTCCTCTTCCCAAGCATGGCTCCGCGCTGTTGGCGCTGGTGGCCCTGGTCGTC
TTGGACTCGGACTCGGCTGCCTCCTTCCAGGAGCATCCAGAACTTCGGCCAGCACTTCTC
CACACAGGAGCAGACCCCCCAGATCTGTGTGGTGGGCAGTGGCCCAGCTGGCTTTTACAC
GGCCCAGCACCTGCTAAAGCACCACTCCCGGGCCCACGTGGATATCTACGAGAAACAGCT
GGTGCCCTTCCGCCTGGTGCGCGTTTGGCTGGCGCTGACCACCCCGAGGTCAAGAATGTT
ACTCAACACCTTTACCCAGACGGCCCGCTCTGACCGCTGTGCCTTCTATGGCAACGTGGA
GGTGGGCAGGGATGTGACTGTGCAGGAGCTGCGGGTGTATCGCCTAACCGCCGTGGTGCT
GAGCTATGGGGCAGAGGACCATCAGGCCCTGGATATCCCTGGTGAGGAGTTGCCCGGCGT
GTTCTCGGCCCGGGCCTTTGTGGGCTGGTACAATGGGCTTCCTGAGAACCGGGAGCTGGC
CCCGGACCTGAGCTGTGACACAGCCGTGATTCTGGGGCAGGGGAATGTGGCTCTGGACGT
GGCCCGGATCCTGCTGACCCCCCCCGACCACCTGGAGAAAACGGACATCACTGAGGCCGC
CCTGGGAGCCCTGAGACAGAGTCGGGTGAAGACGGTGTGGATCGTGGGCCGACGTGGACC
CCTACAAGTGGCCTTCACCATAAAGGAGCTTCGGGAGATGATTCAGTTACCAGGAACTCG
GCCCATGTTGGATCCTGCGGATTTCTTGGGTCTCCAGGACAGAATCAGGGAGGCCGCTCG
CCCGAGGAAGCGGCTGATGGAACTGCTGCTTCGAACAGCCACGGAGAAGCCAGGGGTGGA
GGAGGCTGCCCGCCGGGCATCAGCCTCCCGTGCCTGGGGCCTCCGCTTCTTCCGAAGCCC
GCAGCAGGTCCTGCGCCTGCCAGATGGGCGGGCGCGACGATCCGCCTGGCAGTCACCAGA
ACTGGAGGGCATTGGAGAGGCACACCCGGGCAGTGCCCACTGGGGATGTGGAGGACCTCC
CTGTGGGCTGGTGCTGAGCAGCATTGGGTATAAGAGCCGCCCCATCGACCCCAGTGTGCC
CTTTGACCCCAAGCTCGGGGTTGTCCCCAATATGGAGGGCCGGGTTGTGGATGTGCCAGG
CCTCTACTGCAGCGGCTGGGTGAAGCGGGGACCCACAGGTGTCATCACCACCACCATGAC
CGACAGCTTCCTCACCGGCCAGATTCTGCTACAGGACCTGAAGGCCGGGCACCTGCCGTC
TGGCCCCAGGCCGGGCTCTGCATTCATCAAGGCCCTGCTGGACAGCCGAGGGGTCTGGCC
CGTGTCTTTCTCGGACTGGGAGAAACTGGATGCTGAGGAGGTGTCCCGGGGCCAGGCCTC
GGGGAAGCCCAGAGAGAAGCTGCTGGATCCTCAGGAGAT
Protein Properties
Number of Residues 492
Molecular Weight 54338.0
Theoretical pI 8.58
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>NADPH:adrenodoxin oxidoreductase, mitochondrial
MAPRCWRWWPWSSWTRTRLPPSRSIQNFGQHFSTQEQTPQICVVGSGPAGFYTAQHLLKH
HSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFYGNVEVGRDVTV
QELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTA
VILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIK
ELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRASA
SRAWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIGEATRAVPTGDVEDLPCGLVLSS
IGYKSRPIDPSVPFDPKLGVVPNMEGRVVDVPGLYCSGWVKRGPTGVITTTMTDSFLTGQ
ILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEKLDAEEVSRGQASGKPREKL
LDPQEMLRLLGH
GenBank ID Protein AAA30362.1
UniProtKB/Swiss-Prot ID P08165
UniProtKB/Swiss-Prot Entry Name ADRO_BOVIN
PDB IDs
GenBank Gene ID M17029
GeneCard ID FDXR
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available