Showing Protein Flavin-containing monooxygenase 3 (BMDBP00880)
Identification | |
---|---|
BMDB Protein ID | BMDBP00880 |
Secondary Accession Numbers | None |
Name | Flavin-containing monooxygenase 3 |
Synonyms | Not Available |
Gene Name | FMO3 |
Protein Type | Enzyme |
Biological Properties | |
General Function | Inorganic ion transport and metabolism |
Specific Function | Not Available |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | Not Available |
Locus | Not Available |
SNPs | FMO3 |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 104 |
Molecular Weight | 11349.0 |
Theoretical pI | 4.02 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions | Not Available |
Protein Sequence |
>Flavin-containing monooxygenase 3 VFNDELPACILCGIVTIKPNVKEFTEDSAIFEDGTVFKAIDYVIFATGYSYAYPFLDDSI IKSRDNEVTLFKGIFPPPLEKPTLAVIGLVQSLGAAIPTTDLQS |
External Links | |
GenBank ID Protein | AAN27923.1 |
UniProtKB/Swiss-Prot ID | Q8HYK1 |
UniProtKB/Swiss-Prot Entry Name | Q8HYK1_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | AF488420 |
GeneCard ID | FMO3 |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |