You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00882
Secondary Accession Numbers None
Name Flavin-containing monooxygenase 3
Synonyms Not Available
Gene Name FMO3
Protein Type Enzyme
Biological Properties
General Function Involved in FAD binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs FMO3
Gene Sequence Not Available
Protein Properties
Number of Residues 47
Molecular Weight 5588.0
Theoretical pI 5.68
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Flavin-containing monooxygenase 3
ASIYRSVFTNSSKEMTCFPDFPFPDDFPNFMHNSKLQEYITMFAKEK
GenBank ID Protein AAN27920.1
UniProtKB/Swiss-Prot ID Q8HYK4
UniProtKB/Swiss-Prot Entry Name Q8HYK4_BOVIN
PDB IDs Not Available
GenBank Gene ID AF488417
GeneCard ID FMO3
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available