Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00890
Secondary Accession Numbers
  • BMDBP03083
Name Amine oxidase [flavin-containing] A
Synonyms Not Available
Gene Name MAOA
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.
Pathways Not Available
Reactions
1-Methylhistamine + Water + Oxygen → Methylimidazole acetaldehyde + Ammonia + Hydrogen peroxide details
Norepinephrine + Water + Oxygen → 3,4-Dihydroxymandelaldehyde + Ammonia + Hydrogen peroxide details
Epinephrine + Water + Oxygen → 3,4-Dihydroxymandelaldehyde + Methylamine + Hydrogen peroxide details
Normetanephrine + Water + Oxygen → 3-Methoxy-4-hydroxyphenylglycolaldehyde + Ammonia + Hydrogen peroxide details
Metanephrine + Water + Oxygen → 3-Methoxy-4-hydroxyphenylglycolaldehyde + Ammonia + Hydrogen peroxide details
Dopamine + Water + Oxygen → 3,4-Dihydroxyphenylacetaldehyde + Ammonia + Hydrogen peroxide details
3-Methoxytyramine + Water + Oxygen → Homovanillin + Hydrogen peroxide + Ammonia details
Aminoacetone + Oxygen + Water → Ammonia + Hydrogen peroxide + Pyruvaldehyde details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location X
Locus Not Available
SNPs MAOA
Gene Sequence
>1584 bp
ATGGAGAGTCTGCAGAAGACGAGTGACGCGGGCCAGATGTTCGACGTAGTCGTGATAGGA
GGCGGCATCTCAGGATTATCTGCTGCGAAACTCTTAGCCGAACATGAAGTTAATGTTTTG
GTTTTAGAAGCCCGGGAGAGAGTTGGAGGAAGAACATACACAGTGAGGAATGAACATGTT
GACTACGTAGATGTTGGCGGTGCTTATGTAGGCCCGACCCAGAATAGGATCTTACGGTTA
TCTAAGCAACTGGGTTTAGAAACTTACAAAGTGAATGTAAACGAGCGTCTTGTTCATTAT
GTCAAGGGAAAAACTTATCCATTTCGGGGTGCCTTCCCTCCAGTATGGAATCCCATTGCT
TATCTGGATTACAACAACCTCTGGCGGACCATGGATAACATGGGAAAAGAGATTCCAGCT
GATGCACCATGGGAGGCCCCACATGCAGTGGAATGGGATAAGATGACTATGAAAGATCTC
ATCGAAAAAATCTGCTGGACAAAGACTGCTCGGCAGTTTGCATCTCTCTTTGTGAATATC
AATGTGACCTCTGAACCCCATGAGGTGTCTGCCCTGTGGTTCTTGTGGTACGTGAAACAA
TGTGGGGGCACAACTCGGATATTCTCCATTACCAACGGTGGCCAGGAACGGAAGTTTGTA
GGTGGATCTGGTCAAGTAAGCGAACGGATAATGCAACTCCTAGGGGACAGGGTGAAACTG
AGGAGCCCTGTCACCTATGTTGACCAGTCAAGTGAAAACATCACCGTAGAGACCCTGAAT
CGTGAACTTTATGAGTGCCGGTATGTCATTAGTGCCATCCCACCAACTTTGACTGCCAAG
ATACACTTTAGACCAGAGCTTCCATCAGAGCGAAACCAGCTGATACAGCGTCTTCCAATG
GGGGCTGTCATTAAGTGCATGATGTATTACAAGGAGGCCTTTTGGAAGAAAAAGGATTAC
TGTGGCTGTATGATCATCGAAGATGAGGAAGCTCCAATTTCAATAACACTGGATGATACC
AAGCCAGATGGATCACTGCCTGCTATCATGGGCTTCATCCTCGCTCGAAAAGCTGACCGC
CTCGCTAAAGTGCATAAAGATATAAGGAAAAGAAAAATCTGTGAACGGTACGCCAAAGTG
CTAGGATCTCAAGAAGCTTTACATCCAGTGCACTATGAAGAGAAGAACTGGTGTCAGGAG
CAGTACTCCGGAGGCTGCTACACTGCCTACTTCCCCCCGGGGATCATGACTCAATACGGA
AGGGTTATTCGCCAACCTGTAGGCAGGATTTACTTTGCTGGCACGGAAACTGCCACACAA
TGGAGCGGTTATATGGAAGGAGCAGTAGAGGCTGGTGAACGGGCAGCTAGAGAGGTTTTG
AATGCTTTGGGGAAGCTGTCTGCCAAAGATATCTGGATCCAAGAACCTGAAGCTGAAGAT
GTTCCAGCTGTAGAGATCACCCCCAGCTTCTGGGAGAGAAACCTGCCTTCCGTATCAGGC
CTGCTGAAGATTGTTGGGTTTTCCACATCGATAACTGCCCTGTGGTTTGTGATGTACAGA
TTCAGGCTGCTAAGCCGATCCTGA
Protein Properties
Number of Residues 527
Molecular Weight 59758.0
Theoretical pI 8.12
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 498-518
Protein Sequence
>Amine oxidase [flavin-containing] A
MESLQKTSDAGQMFDVVVIGGGISGLSAAKLLAEHEVNVLVLEARERVGGRTYTVRNEHV
DYVDVGGAYVGPTQNRILRLSKQLGLETYKVNVNERLVHYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEIPADAPWEAPHAVEWDKMTMKDLIEKICWTKTARQFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVGGSGQVSERIMQLLGDRVKL
RSPVTYVDQSSENITVETLNRELYECRYVISAIPPTLTAKIHFRPELPSERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTKPDGSLPAIMGFILARKADR
LAKVHKDIRKRKICELYAKVLGSQEALHPVHYEEKNWCQEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKLSAKDIWIQEPEAED
VPAVEITPSFWERNLPSVSGLLKIVGFSTSITALWFVMYRFRLLSRS
GenBank ID Protein CAA33632.1
UniProtKB/Swiss-Prot ID P21398
UniProtKB/Swiss-Prot Entry Name AOFA_BOVIN
PDB IDs Not Available
GenBank Gene ID X15609
GeneCard ID MAOA
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available