Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00906
Secondary Accession Numbers None
Name Methylenetetrahydrofolate reductase
Synonyms Not Available
Gene Name MTHFR
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a co-substrate for homocysteine remethylation to methionine.
Pathways
  • Folate Metabolism
  • Methionine Metabolism
  • One-carbon metabolism
  • Tetrahydrofolate interconversion
Reactions
5,10-Methylene-THF + NADH → 5-Methyltetrahydrofolic acid + NAD details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus Not Available
SNPs MTHFR
Gene Sequence
>1968 bp
ATGGTGAACGAACCCAGAGGGAACGGCAGCCCCGGCCCCCGCTGGGAGGGCAGCAGCAGC
GGCAGCGAGAGCTCAAGGACAAGTTCAAGGTGCTCCACGCCGGGGTTGGACCCCGAGCGA
TGCGAGAGACTCCGGGAGAAGATGAAGCGGAAGATGGACTCTGGAGACAAGTGGTTCTCC
CTAGAGTTCTTCCCTCCCCGAACTGCCCAGGGTGCTGTCAATCTCATCTCCAGGTTTGAC
CGGATGGGAGCGGGTGGCCCCCTCTTTGTAGACGTGACCTGGCACCCAGCCGGGGATCCT
GGCTCCGACAAGGAGACCTCGTCCATGGTGATTGCCAGCACTGCCGTGAACTACTGCGGC
CTCGAGACAATCCTGCACATGACCTGCTGCCATCAGAGCCGTGAAGAGATCACGGGCCAC
CTGAACAAAGCCAAGCAGCTGGGCCTGAAGAACATCCTGGCGCTGAGGGGAGACCCCATA
GGTGACCAATGGGAAGAGGAGGAAGGAGGCTTCAACTATGCTACGGACTTGGTGAAGCAC
ATCCGAAACGAGTTTGGTGACTACTTTGACGTCTGTGTGGCAGGTTACCCCAAAGGCCAC
CCTGAAGGAGAGAGCTTTGAGGCTGATCTGAAGCACCTGAAGGAGAAGGTGGCTGCAGGA
GCCGACTTCATCATCACCCAGCTATTCTTTGAGGCTGAAACATTCTTCCGCTTTGTGAAG
GCTTGCTCCGAGATAGGCATTACCTGCCCCGTCCTCCCCGGCATCTTCCCAATTCAGGGC
TACCACTCCCTCCGGCAGCTGGTGAAACTGTCCAAACTGGAGGTGCCACAGCAGATCAAG
GATGTGATCGAGCCCATCAAAGACAATGATGCTGCCATCCGCAACTATGGCATCGAGCAG
GCCGTGAGCCTGTGCCAGGAGCTGCTGGCCAGTGGCTTGGTTCCAGGCCTCCACTTCTAC
ACCCTCAACCGCGAGGTGGCCACCATCGAGGTGCTGAAGCGCCTGGGGCTTTGGATTGAG
GACCCTAGGCGTCCCCTGCCCTGGGCCCTCAGTGCCCACCCCAAGCGCCGGGTGGAGGAT
GTCCGGCCCATCTTCTGGGCCTCGAGACCAAAGAGTTACATTTACCGTACGCAGGAGTGG
GACGAGTTCCCCAATGGCCGCTGGGGCAATTCCTCCTCTCCGGCCTTTGGGGAGCTGAAG
GACTACTACCTCTTCTACCTAAAGAGCAAGTCCCCGAAGGAGGAGCTGCTCAAGATGTGG
GGGGAGGAGCTGACCAGTGAGGAAAGCGTCTTCCAAGTCTTTGCCCACCACCTCTCGGGA
GAGCCCAACCAGAATGGCTACAAAGTGACTTGCCTGCCCTGGAATGATGAGCCCCTGGCA
GCCGAGACCAGCCTGATGAAGGAGGAGCTGCTGAGAGTGAACCGGCGAGGCATCCTCACC
ATCAACTCCCAGCCCAACATCAACGGGAAGCCGTCCTCTGACCCCATCGTGGGCTGGGGC
CCCAGTGGGGGCTATGTCTTCCAGAAGGCCTACTTAGAGTTCTTCACTTCCCGAGAAACG
GTGGAGGCGCTTTTGCAGGTGCTGAAGAAGTATGAACTCCGGGTGAATTACCACATCGTG
GATGTGAAGGGTGAAAATATCACCAACGCCCCTGAGCTGCAACCCAACGCGGTCACCTGG
GGCATCTTCCCTGGCCGAGAGATCATCCAGCCCACAGTGGTGGACCCGGTCAGCTTCATG
TTCTGGAAGGATGAGGCCTTCGCGCTGTGGATTGAGCAGTGGGGCAAGCTGTATGAGGAG
GAGTCCCCCTCCCGCATGATCATCCAGTACATCCACGACAACTACTTCCTGGTCAACCTG
GTGGACAACGAGTTTCCGCTGGACAACTGCCTGTGGCAGGTGGTGGAAGACACGTTTGAG
CTTCTCAGCAGGCCCCCCCAAGACAAGAGGGAGACAGAGGCGCTGTGA
Protein Properties
Number of Residues 655
Molecular Weight 74485.0
Theoretical pI 5.1
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Methylenetetrahydrofolate reductase
MVNEPRGNGSPGPRWEGSSSGSESSRTSSRCSTPGLDPERCERLREKMKRKMDSGDKWFS
LEFFPPRTAQGAVNLISRFDRMGAGGPLFVDVTWHPAGDPGSDKETSSMVIASTAVNYCG
LETILHMTCCHQSREEITGHLNKAKQLGLKNILALRGDPIGDQWEEEEGGFNYATDLVKH
IRNEFGDYFDVCVAGYPKGHPEGESFEADLKHLKEKVAAGADFIITQLFFEAETFFRFVK
ACSEIGITCPVLPGIFPIQGYHSLRQLVKLSKLEVPQQIKDVIEPIKDNDAAIRNYGIEQ
AVSLCQELLASGLVPGLHFYTLNREVATIEVLKRLGLWIEDPRRPLPWALSAHPKRRVED
VRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPKEELLKMW
GEELTSEESVFQVFAHHLSGEPNQNGYKVTCLPWNDEPLAAETSLMKEELLRVNRRGILT
INSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLKKYELRVNYHIV
DVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIEQWGKLYEE
ESPSRMIIQYIHDNYFLVNLVDNEFPLDNCLWQVVEDTFELLSRPPQDKRETEAL
GenBank ID Protein AAW39033.1
UniProtKB/Swiss-Prot ID Q5I598
UniProtKB/Swiss-Prot Entry Name MTHR_BOVIN
PDB IDs Not Available
GenBank Gene ID AY854631
GeneCard ID MTHFR
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available