Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00910
Secondary Accession Numbers None
Name 7-dehydrocholesterol reductase
Synonyms Not Available
Gene Name DHCR7
Protein Type Enzyme
Biological Properties
General Function Involved in 7-dehydrocholesterol reductase activity
Specific Function Production of cholesterol by reduction of C7-C8 double bond of 7-dehydrocholesterol (7-DHC).
Pathways
  • Cholesterol biosynthesis
  • Steroid Biosynthesis
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 29
Locus Not Available
SNPs DHCR7
Gene Sequence
>1428 bp
ATGGCTGCGAAGTCCCAGCCCAGCGCCCCTAAAACCAAGAGCACCAGCGGCCTCACCAAC
GGCAACGCTGCAGCCCAAGGCCAGTGGGGCCGAGCCTGGGAGGTGGACTGGTTTTCCCTG
GCGAGCGTCATCTTCCTGCTGCTGTTTGCGCCCTTCATCGTGTACTACTTCATCATGGCC
TGCGACCAGTACGGCTGCTCCCTGACAGTGCCCGTGGCGGACCTCGCCACTGGGCGGGCT
CGGCTCGCCGACATCTGGGCCAGGACGCCGCCCGTGACCGCAAAGGCGGCCCAGATCTAC
ACAGCATGGGTCACGCTCCAGGTGCTTCTGTACATGCTGCTTCCTGACTTCTGCCACAAG
TTTCTTCCGGGCTACGTGGGGGGCGTTCAGGAGGGCGCCGTGACTCCCGCAGGAGCCGTC
AACAAGTATGAGATCAACGGCCTGCAGGCCTGGCTCCTCACGCACCTCCTGTGGTTCGCC
AACGCCCACCTCCTCGGCTGGTTCTCCCCCACCATCATTTTCGACAACTGGATCCCGCTG
CTCTGGTGTGCCAACATCCTGGGCTACACCGTCTCCACCTTCGCCATGGTCAAGGGCTAC
CTCTTCCCCACTGACGCCCGGGAATGCAAATTCACGGGCAATTTCTTTTACAACTACATG
ATGGGCGTTGAGTTTAACCCCCGAATTGGGAAGTGGTTTGACTTCAAGCTCTTCTTCAAT
GGACGCCCCGGGATCGTCGCCTGGACCCTCATCAACCTGTCCTTTGCAGCCAAGCAGCAG
GAGCTCTACGGCCACGTGACCAACTCCATGGTCTTGGTCAACATCCTGCAGGCCATCTAC
GTGCTGGACTTCTTCTGGAACGAAACCTGGTACCTGAAAACCATCGACATCTGCCACGAC
CACTTTGGGTGGTACCTGGGCTGGGGGGACTGCGTCTGGCTGCCATACCTGTACACGCTG
CAGGGCCTGTACCTGGTGTACCACCCCGTGCAGCTGCCCACCTACTACGCGCTGGGCGTC
CTGCTCCTGGGCCTGCTCGGCTACTACATCTTCCGGATGACCAACCACCAGAAGGACCTC
TTCCGCCGCACGGACGGGCGCTGCCTGATCTGGGGCAGGAAGCCCAAGGCCATCGAGTGC
TCCTACACATCAGCCGACGGGCAGAGACACCACAGCAAGCTGCTGGTCTCGGGCTTCTGG
GGCGTGGCCCGCCACTTCAACTACACGGGTGACCTGATGGGCAGCCTGGCGTACTGCCTG
GCCTGCGGCGGCGGCCACCTCCTGCCCTACTTCTACATCATCTTCATGGCCATCCTGCTG
ACCCACCGCTGCCTCCGGGACGAGCACCGCTGTGCCAACAAGTACGGCCGCGACTGGGAG
CACTACACGGCCGCCGTGCCGTACCGCCTGCTCCCTGGCATCTTCTAG
Protein Properties
Number of Residues 475
Molecular Weight 54271.0
Theoretical pI 8.53
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 40-60
  • 151-173
  • 178-200
  • 266-286
  • 306-326
  • 331-351
  • 420-440
Protein Sequence
>7-dehydrocholesterol reductase
MAAKSQPSAPKTKSTSGLTNGNAAAQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA
CDQYGCSLTVPVADLATGRARLADIWARTPPVTAKAAQIYTAWVTLQVLLYMLLPDFCHK
FLPGYVGGVQEGAVTPAGAVNKYEINGLQAWLLTHLLWFANAHLLGWFSPTIIFDNWIPL
LWCANILGYTVSTFAMVKGYLFPTDARECKFTGNFFYNYMMGVEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQQELYGHVTNSMVLVNILQAIYVLDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLPTYYALGVLLLGLLGYYIFRMTNHQKDL
FRRTDGRCLIWGRKPKAIECSYTSADGQRHHSKLLVSGFWGVARHFNYTGDLMGSLAYCL
ACGGGHLLPYFYIIFMAILLTHRCLRDEHRCANKYGRDWEHYTAAVPYRLLPGIF
GenBank ID Protein AAX08942.1
UniProtKB/Swiss-Prot ID Q5E9J5
UniProtKB/Swiss-Prot Entry Name DHCR7_BOVIN
PDB IDs Not Available
GenBank Gene ID BT020925
GeneCard ID DHCR7
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available