Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00930
Secondary Accession Numbers None
Name Glycerol kinase
Synonyms Not Available
Gene Name GK
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function Key enzyme in the regulation of glycerol uptake and metabolism.
Pathways
  • Glycerol degradation via glycerol kinase pathway
  • Glycerolipid Metabolism
  • Polyol metabolism
  • Sn-glycerol 3-phosphate from glycerol: step 1/1
Reactions
Glycerol + Adenosine triphosphate → Glycerol 3-phosphate + ADP details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location X
Locus Not Available
SNPs GK
Gene Sequence
>1680 bp
ATGGCATCCGCGAAGAAAGCAGTTTTGGGGCCCTTGGTGGGAGCAGTGGACCAGGGCACC
AGCTCGACGCGCTTTCTGGTTTTCAATTCAAAAACAGCCGAACTACTTAGTCATCATCAA
GTGGAAATAAAACAAGAGTTTCCAAGAGAAGGGTGGGTGGAGCAGGACCCTAAGGAAATT
CTGCAGTCTGTCTATGAGTGTATAGAGAAAACGTGTGAGAAACTCGGGCAGCTCAATATT
GATATTTCCAACATAAAAGCTATTGGTGTCAGTAACCAGAGGGAAACCACTGTAGTCTGG
GACAAGTTAACTGGAGAACCTCTCTACAACGCTGTGGTGTGGCTTGACCTAAGAACCCAG
TCTACTGTTGAGAGTCTTAGTAAAAGAATCCCAGGAAATAATAACTTTGTCAAGTCCAAG
ACAGGCCTTCCACTTAGCACTTATTTCAGTGCGGTGAAGCTTCGTTGGCTCCTTGACAAT
GTGAGAAAAGTTCAAAAGGCCGTTGAAGAAGATAGAGCTCTTTTTGGGACCATTGATTCA
TGGCTTATTTGGAGCTTGACAGGAGGAGCCAGTGGAGGGGTCCATTGTACAGATGTAACA
AATGCAAGCAGGACAATGCTTTTCAACATCCATTCTTTGGAATGGGATAAAGAGCTCTGC
GAATTTTTTGAAATTCCAATGAAAATTCTTCCAAATGTCCGGAGTTCTTCAGAGATCTAT
GGCCTAATGAAAATCTCTCATAGCCCGAAAGCTGGGGCCTTGGAAGGTGTGCCAATATCT
GGGTGTTTGGGAGACCAGTCTGCTGCGTTGGTAGGACAAATGTGCTTCCAAGATGGACAA
GCCAAAAACACGTATGGAACAGGCTGCTTCTTACTATGTAATACAGGCCGTAAGTGTGTA
TTTTCTGAACATGGCCTTCTGACCACAGTGGCTTACAAACTCGGCAGAGATAAACCCGTA
TATTATGCATTAGAAGGTTCAGTAGCTATAGCTGGTGCTGTTATTCGCTGGCTTAGAGAC
AATCTTGGAATTATAAAAAGCTCCGAGGAAATTGAAAAACTTGCTAAAGAAGTAGGTACT
TCTTATGGCTGCTATTTCGTCCCAGCATTTTCGGGGCTGTATGCACCTTATTGGGAGCCC
AGTGCAAGAGGGATCATCTGTGGGCTCACTCAGTTCACCAATAAATGCCATATTGCTTTT
GCTGCATTAGAAGCTGTTTGTTTCCAAACTCGAGAGATTTTGGACGCCATGAACCGTGAC
TGTGGAATTCCACTCAGCCATTTGCAGGTAGATGGTGGAATGACCAACAACAAAATCCTT
ATGCAGTTACAAGCAGACATTCTGTATATTCCAGTAGTGAAACCATCCATGCCTGAAACA
ACTGCTCTGGGAGCCGCCATGGCTGCAGGGGCTGCAGAAGGGGTTGGCGTCTGGAGTCTG
GAGCCTGAGGACTTGTCGGCTGTCACAATGGAGCGATTTGAACCTCAGATCAACGCTGAG
GAAAGTGAAATTCGTTATTCTACATGGAAGAAAGCTGTGATGAAATCAATGGGTTGGGTT
ACAACTCAGTCTTCAGAAAGTGGTGACCCTAGTATCTTCTGTAGTCTGCCCTTGGGCTTT
TTTATAGTGAGTAGCGTGGTAATGTTAATCGGAGCAAGGTACCTCTCAGGTATGCCGTAA
Protein Properties
Number of Residues 559
Molecular Weight 61261.0
Theoretical pI 5.93
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Glycerol kinase
MASAKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEDRALFGTIDS
WLIWSLTGGASGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFEIPMKILPNVRSSSEIY
GLMKISHSPKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGRKCV
FSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLAKEVGT
SYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD
CGIPLSHLQVDGGMTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSL
EPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSSESGDPSIFCSLPLGF
FIVSSVVMLIGARYLSGMP
GenBank ID Protein AAI22693.1
UniProtKB/Swiss-Prot ID Q0IID9
UniProtKB/Swiss-Prot Entry Name GLPK_BOVIN
PDB IDs Not Available
GenBank Gene ID BC122692
GeneCard ID GK
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available