Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00952
Secondary Accession Numbers None
Name Sialidase-1
Synonyms Not Available
Gene Name NEU1
Protein Type Enzyme
Biological Properties
General Function Involved in exo-alpha-sialidase activity
Specific Function Catalyzes the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins and glycolipids. To be active, it is strictly dependent on its presence in the multienzyme complex. Appears to have a preference for alpha 2-3 and alpha 2-6 sialyl linkage (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 23
Locus Not Available
SNPs NEU1
Gene Sequence
>1248 bp
ATGACTGAAGAGGGACCCGGTATAGTGTCCTTGGGCAAACTCAGGAGACCGCGAATGCTG
CGATTATGGGGAATCTGTAGGGTTCAGATATTTTCTGCGATCTTCATGCTAATGTCTCCT
GCAGGAGTCGGGGCCGGAGCAAAGGATGACTTCAGTCTGGTTCATCCACTTGTGACCATG
GAACAACTTCTGTGGGTGAGTGGGAAGCAAATCGGCTCCGTGGACACTTTCCGAATCCCG
CTCATCACCACCACTCCTCGGGGCACTCTCCTTGCCTTTGCTGAGGCCAGAAAAATGTCG
ACATCGGATAAAGGAGCTAAATTCATAGCTCTGCGGAGGTCTATGGACCAGGGCAGCACA
TGGTCTCCGACAGCTTTCATTGTGGATGATGGGGAGACCCCAGATGGGCTGAACTTGGGG
GCAGTGGTGAGCGACACGACGACAGGCGTGGTCTTCCTTTTCTACTCCCTCTGTGCTCAT
AAGGCTGGCTGCCAGGTGGCCTCTACCATGCTGGTGTGGAGTAAGGATGATGGTGTTTCC
TGGAGCTCGCCGCGGAACCTCTCCCTGGATATAGGCACCGAGATGTTTGCCCCAGGACCG
GGCTCTGGCATTCAGAAACAGCGGGAGCCTCGGAAGGGCCGACTTATCGTGTGTGGCCAC
GGAACGCTGGAGCGGGATGGGGTTTTCTGCCTGCTCAGCGATGATCATGGCGTCTCCTGG
CGCTACGGAGGTGGGGTCAGTGGCATCCCCTACGGCCAGCCCAAGCGGGAAAATGACTTC
AACCCCGATGAGTGCCAGCCCTACGAGCTCCCCGATGGCTCAGTCGTCATCAACGCGCGG
AACCAAAACAACTACCACTGCCATTGCCGCATCATCCTCCGCAGCTACGACGCCTGTGAC
ACCCTGAGGCCTCGGGATGTGACCTTTGACACGGAGCTCGTGGACCCTGTGGTAGCTGCA
GGGGCTGTAGCCACCAGCTCTGGCATTGTCTTCTTCTCCAACCCAGCCCATCCAGAGTTC
CGAGTAAACCTGACCCTGCGCTGGAGCTTCAGCAATGGTACCTCCTGGAGGAAGGAGACG
GTCCAGCTGTGGCCGGGGCCCAGTGGCTATTCATCGCTGACCACCCTGGAGGGCAACGTG
GATGGGAAGGATGAGGCCCCACAGCTCTACGTCCTGTATGAGAAAGGCCGGAACCAGTAC
ATGGAGAGCATCTCTCTGGTCAAAGTCAGCGTCTACGGAACACTGTGA
Protein Properties
Number of Residues 415
Molecular Weight 45433.0
Theoretical pI 6.85
Pfam Domain Function Not Available
Signals
  • 1-47
Transmembrane Regions Not Available
Protein Sequence
>Sialidase-1
MTEEGPGIVSLGKLRRPRMLRLWGICRVQIFSAIFMLMSPAGVGAGAKDDFSLVHPLVTM
EQLLWVSGKQIGSVDTFRIPLITTTPRGTLLAFAEARKMSTSDKGAKFIALRRSMDQGST
WSPTAFIVDDGETPDGLNLGAVVSDTTTGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVS
WSSPRNLSLDIGTEMFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGVSW
RYGGGVSGIPYGQPKRENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIILRSYDACD
TLRPRDVTFDTELVDPVVAAGAVATSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKET
VQLWPGPSGYSSLTTLEGNVDGKDEAPQLYVLYEKGRNQYMESISLVKVSVYGTL
GenBank ID Protein BAF64705.1
UniProtKB/Swiss-Prot ID A6BMK7
UniProtKB/Swiss-Prot Entry Name NEUR1_BOVIN
PDB IDs Not Available
GenBank Gene ID AB327106
GeneCard ID NEU1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available