Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP00958
Secondary Accession Numbers None
Name Glycogen [starch] synthase, muscle
Synonyms Not Available
Gene Name GYS1
Protein Type Enzyme
Biological Properties
General Function Cell wall/membrane/envelope biogenesis
Specific Function Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
Pathways
  • Glycan biosynthesis
  • Glycogen biosynthesis
  • Starch and Sucrose Metabolism
Reactions
Uridine diphosphate glucose → Amylose + Uridine 5'-diphosphate details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 18
Locus Not Available
SNPs GYS1
Gene Sequence
>2211 bp
ATGCCTCTAAACCGCACTTTGTCCATGTCCTCCCTGCCAGGACTGGAGGACTGGGAGGAT
GAATTCGACCTGGAGAACACAGTGCTCTTCGAGGTGGCCTGGGAGGTGGCCAACAAGGTG
GGCGGGATCTACACAGTGCTGCAGACGAAGGCAAAGGTGACGGGGGACGAGTGGGGTGAC
AACTACTACCTGGTGGGACCGTACACGGAGCAGGGCGTGAGGACCCAGGTGGAGCTGCTG
GAACCCCCGACCCCGGCCCTGAAGAGGACGCTGGACTCCATGAACAGCAAGGGCTGCAAG
GTGTACTTCGGGCGCTGGCTGATTGAGGGGGGCCCCCTGGTGGTGCTCCTCGATGTGGGG
GCCTCAGCCTGGGCCCTGGAGCGCTGGAAGGGGGAGCTATGGGACACATGCAACATCGGG
GTGCCCTGGTACGACCGGGAGGCCAACGACGCCGTCCTTTTTGGCTTCCTCACCACCTGG
TTCCTGGGTGAGTTCCTGGCCCAGAGCGAGGAGAAACCACACGTGGTCGCACACTTCCAC
GAGTGGTTGGCAGGTGTCGGGCTCTGCCTGTGCCGCGCCCGGCGGCTGCCCGTGGCTACC
ATCTTCACCACCCACGCCACGCTGCTGGGGCGATACCTGTGTGCTGGGGCTGTGGACTTC
TACAACAACCTGGAGAATTTCAACGTGGACAAAGAAGCAGGTGAGAGGCAAATCTATCAC
CGCTACTGCATGGAGCGGGCCGCAGCCCACTGCGCTCATGTCTTCACTACTGTGTCCCAG
ATTACCGCCATTGAGGCTCAGCACCTACTCAAAAGGAAACCAGATATCGTGACCCCCAAT
GGACTGAATGTGAAGAAATTCTCTGCCATGCATGAGTTCCAGAACCTCCATGCTCAGAGC
AAGGCTCGAATCCAGGAGTTTGTGCGGGGCCATTTTTATGGGCACCTAGACTTCAACTTG
GACAAGACCTTGTACTTCTTTATCGCCGGCCGCTATGAGTTCTCCAACAAGGGGGCTGAC
GTCTTCCTGGAGGCCTTGGCCCGGCTCAACTATCTGCTCAGAGTGAATGGCAGTGAGCAG
ACGGTGGTCGCCTTCTTCATCATGCCGGCTCGGACCAACAATTTCAACGTGGAAACCCTT
AAGGGCCAGGCCGTGCGCAAGCAGCTTTGGGATACGGCCAACACAGTGAAGGAAAAGTTT
GGGAGGAAGCTTTACGAATCCTTGCTGGTGGGGAGCCTCCCAGACATGAACAAGATGCTG
GACAAGGAGGACTTCACTATGATGAAGAGAGCTATCTTTGCCACACAGCGGCAATCTTTC
CCTCCTGTGTGCACCCACAATATGCTGGATGACTCCTCAGACCCCATCTTGACAACCATC
CGCCGAATCGGCCTCTTTAATAGTAGTGCTGACAGAGTCAAGGTGATTTTTCACCCGGAG
TTCCTGTCTTCTACGAGCCCTCTGCTCCCTGTGGACTATGAGGAATTTGTCCGTGGCTGC
CACCTTGGGGTCTTCCCCTCCTACTATGAGCCTTGGGGCTACACACCAGCTGAATGCACG
GTAATGGGTATCCCCAGTGTCTCCACCAACCTCTCCGGATTCGGCTGCTTCATGGAGGAA
CACATCGCAGACCCCTCAGCTTACGGTATCTACATTCTGGACCGGCGATTCCGCAGTCTG
GATGATTCCTGCTCGCAGCTCACCTCCTTCCTCTACAGTTTCTGCCAGCAGAGCCGAAGG
CAGCGCATTATCCAGCGGAACCGAACGGAGCGCCTCTCTGACCTTCTGGACTGGAAATAC
CTAGGCCGGTACTACATGTCAGCGCGCCACATGGCGCTGGCCAAGGCCTTTCCAGAATAC
TTCACCTACGAGCCTCACGAGGCTGACGCGACCCAGGGCTACCGCTACCCACGGCCAGCC
TCAGTGCCACCATCACCCTCGCTGTCGCGACACTCCAGCCCGCACCAGAGCGAGGATGAG
GAGGAACCCCGGGACTTACCACCTGATGAAGATGACGAGCGCTACGACGAGGACGAGGAG
GCCGCCAAGGACCGGCGCAACATCCGCGCCCCCGAGTGGCCACGCCGCGCCTCCTGCACC
TCTTCCACCGGGAGCAAGCGTGGGTCTGTGGACACAGCGCCCTCCAGCTCAGTCAGCACC
CCCAGCGAACCCCTTAGCCCCGCCAGCTCCCTGGGCGAGGAACGCAACTAA
Protein Properties
Number of Residues 736
Molecular Weight 83814.0
Theoretical pI 5.92
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Glycogen [starch] synthase, muscle
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEYFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDLPPDEDDERYDEDEEAAKDRRNIRAPEWPRRASCTSSTGSKRGSVDTAPSSSVST
PSEPLSPASSLGEERN
GenBank ID Protein AAI51382.1
UniProtKB/Swiss-Prot ID A7MB78
UniProtKB/Swiss-Prot Entry Name GYS1_BOVIN
PDB IDs Not Available
GenBank Gene ID BC151381
GeneCard ID GYS1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available