Identification
BMDB Protein ID BMDBP00965
Secondary Accession Numbers None
Name Similar to B15 subunit of the NADH: ubiquinone oxidoreductase complex
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Involved in NADH dehydrogenase (ubiquinone) activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus Not Available
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 97
Molecular Weight 11168.0
Theoretical pI 9.87
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Similar to B15 subunit of the NADH: ubiquinone oxidoreductase complex
MSFPKYEASRLSSLPTTLDPAEYDISSETRKAQAERLAIRSRLKREYQLQYYDPSRRGVI
EDPALVRWTYARSANIYPNFRPNTKTSLLGALLELGP
GenBank ID Protein BAC56436.1
UniProtKB/Swiss-Prot ID Q862N3
UniProtKB/Swiss-Prot Entry Name Q862N3_BOVIN
PDB IDs Not Available
GenBank Gene ID AB098946
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available