Showing Protein Ubiquitin-conjugating enzyme E2 N (BMDBP00970)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00970 |
| Secondary Accession Numbers | None |
| Name | Ubiquitin-conjugating enzyme E2 N |
| Synonyms | Not Available |
| Gene Name | UBE2N |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in ATP binding |
| Specific Function | The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains. This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UB2V1, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIG-I/DDX58 to activate the downstream signaling pathway that leads to interferon beta production (By similarity). |
| Pathways |
|
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 5 |
| Locus | Not Available |
| SNPs | UBE2N |
| Gene Sequence |
>459 bp ATGGCCGGGCTGCCCCGCAGGATTATCAAGGAAACCCAGCGTTTGCTGGCAGAACCAGTT CCCGGCATTAAAGCAGAACCAGATGAGAGCAACGCCCGTTATTTTCATGTGGTCATTGCC GGCCCTCAGGATTCCCCCTTTGAGGGAGGGACTTTTAAACTTGAACTATTCCTTCCAGAA GAATACCCAATGGCAGCCCCTAAAGTACGTTTCATGACCAAAATTTATCATCCTAATGTA GACAAGTTGGGAAGAATATGTTTAGATATTTTGAAAGATAAGTGGTCCCCAGCACTGCAG ATCCGCACAGTTCTGCTATCGATCCAGGCTTTGTTAAGTGCTCCCAATCCAGATGATCCA TTAGCAAATGATGTAGCGGAGCAATGGAAGACCAATGAAGCCCAAGCCATAGAAACAGCT AGAGCATGGACTAGGCTATATGCCATGAATAATATTTAA |
| Protein Properties | |
| Number of Residues | 152 |
| Molecular Weight | 17138.0 |
| Theoretical pI | 6.53 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Ubiquitin-conjugating enzyme E2 N MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP LANDVAEQWKTNEAQAIETARAWTRLYAMNNI |
| External Links | |
| GenBank ID Protein | AAI19932.1 |
| UniProtKB/Swiss-Prot ID | Q0P5K3 |
| UniProtKB/Swiss-Prot Entry Name | UBE2N_BOVIN |
| PDB IDs | |
| GenBank Gene ID | BC119931 |
| GeneCard ID | UBE2N |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |