Showing Protein Ubiquitin-conjugating enzyme E2 D3 (BMDBP00971)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00971 |
| Secondary Accession Numbers | None |
| Name | Ubiquitin-conjugating enzyme E2 D3 |
| Synonyms | Not Available |
| Gene Name | UBE2D3 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in ATP binding |
| Specific Function | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'-linked polyubiquitination. Cooperates with the E2 CDC34 and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Ubiquitin chain elongation is then performed by CDC34, building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. Acts also as an initiator E2, in conjunction with RNF8, for the priming of PCNA. Monoubiquitination of PCNA, and its subsequent polyubiquitination, are essential events in the operation of the DNA damage tolerance (DDT) pathway that is activated after DNA damage caused by UV or chemical agents during S-phase. Associates with the BRCA1/BARD1 E3 ligase complex to perform ubiquitination at DNA damage sites following ionizing radiation leading to DNA repair. Targets DAPK3 for ubiquitination which influences promyelocytic leukemia protein nuclear body (PML-NB) formation in the nucleus. In conjunction with the MDM2 and TOPORS E3 ligases, functions ubiquitination of p53/TP53. Supports NRDP1-mediated ubiquitination and degradation of ERBB3 and of BRUCE which triggers apoptosis. In conjunction with the CBL E3 ligase, targets EGFR for polyubiquitination at the plasma membrane as well as during its internalization and transport on endosomes. In conjunction with the STUB1 E3 quality control E3 ligase, ubiquitinates unfolded proteins to catalyze their immediate destruction. Together with RNF135, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIG-I/DDX58 to activate the downstream signaling pathway that leads to interferon beta production (By similarity). |
| Pathways |
|
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 6 |
| Locus | Not Available |
| SNPs | UBE2D3 |
| Gene Sequence |
>444 bp ATGGCGCTGAAACGGATTAATAAGGAACTTAGTGATTTGGCCCGTGACCCTCCAGCACAA TGTTCTGCAGGTCCAGTTGGGGATGATATGTTTCATTGGCAAGCCACAATTATGGGACCT AATGACAGCCCATATCAAGGCGGTGTATTCTTTTTGACAATTCATTTTCCTACAGACTAC CCCTTCAAACCACCTAAGGTTGCATTTACAACAAGAATTTATCATCCAAATATTAACAGT AATGACAGCATTTGTCTCGATATTCTAAGATCACAGTGGTCTCCTGCTTTAACTATTTCT AAAGTTCTTTTATCCATTTGTTCACTGCTATGTGATCCAAACCCAGATGACCCCCTAGTG CCAGAGATTGCACGGATCTATAAAACAGACAGAGATAAGTACAACAGAATATCTCGGGAA TGGACTCAGAAGTATGCCATGTGA |
| Protein Properties | |
| Number of Residues | 147 |
| Molecular Weight | 16745.0 |
| Theoretical pI | 7.38 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Ubiquitin-conjugating enzyme E2 D3 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY PFKPPKVAFTTRIYHPNINSNDSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV PEIARIYKTDRDKYNRISREWTQKYAM |
| External Links | |
| GenBank ID Protein | AAI02426.1 |
| UniProtKB/Swiss-Prot ID | Q3ZCF7 |
| UniProtKB/Swiss-Prot Entry Name | UB2D3_BOVIN |
| PDB IDs | |
| GenBank Gene ID | BC102425 |
| GeneCard ID | UBE2D3 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |