Showing Protein Aldehyde dehydrogenase, dimeric NADP-preferring (BMDBP00986)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00986 |
| Secondary Accession Numbers | None |
| Name | Aldehyde dehydrogenase, dimeric NADP-preferring |
| Synonyms | Not Available |
| Gene Name | ALDH3A1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde (Probable). They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation (Probable). Oxidizes medium and long chain aldehydes into non-toxic fatty acids (By similarity). Preferentially oxidizes aromatic aldehyde substrates (By similarity). Comprises about 50 percent of corneal epithelial soluble proteins (By similarity). May play a role in preventing corneal damage caused by ultraviolet light (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 19 |
| Locus | Not Available |
| SNPs | ALDH3A1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 239 |
| Molecular Weight | 26743.0 |
| Theoretical pI | 8.35 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Aldehyde dehydrogenase, dimeric NADP-preferring NPHYVDKDRDLDIACRRIAWGKFMNSGQTCVAPDYILCDPSIQSQVVEKLKKSLKEFYGE DAKKSRDYGRIINSRHFQRVMGLLEGQKVAYGGTGDATTRYIAPTILTDVDPESPVMQEE VFGPVLPIMCVRSLEEAIQFITQREKPLALYVFSPNDKVIKKMIAETSSGGVTANDVVVH ISVHSLPYGGVGDSGMGSYHGRKSFETFSHRRSCLVRPLLNEETLKARYPRARPICPDT |
| External Links | |
| GenBank ID Protein | AAB24736.2 |
| UniProtKB/Swiss-Prot ID | P30907 |
| UniProtKB/Swiss-Prot Entry Name | AL3A1_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | S51969 |
| GeneCard ID | ALDH3A1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |