Showing Protein Angiotensin-converting enzyme (BMDBP01005)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01005 |
| Secondary Accession Numbers | None |
| Name | Angiotensin-converting enzyme |
| Synonyms | Not Available |
| Gene Name | ACE |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in carboxypeptidase activity |
| Specific Function | Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 19 |
| Locus | Not Available |
| SNPs | ACE |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 100 |
| Molecular Weight | 10681.0 |
| Theoretical pI | 3.95 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Angiotensin-converting enzyme MGAASGRRSPPLLLPLLLLLLPPPPVILELDPALQPGNFPADEAGAQIFAASFNSSAEQV LFQSTAASWAHDTNITEENARLQEEAALLSQEFSEAWGQK |
| External Links | |
| GenBank ID Protein | ABI35897.2 |
| UniProtKB/Swiss-Prot ID | P12820 |
| UniProtKB/Swiss-Prot Entry Name | ACE_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | DQ885942 |
| GeneCard ID | ACE |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |