Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01049
Secondary Accession Numbers None
Name A disintegrin and metalloproteinase with thrombospondin motifs 2
Synonyms Not Available
Gene Name ADAMTS2
Protein Type Enzyme
Biological Properties
General Function Involved in metalloendopeptidase activity
Specific Function Cleaves the propeptides of type I and II collagen prior to fibril assembly (PubMed:7622483). Does not act on type III collagen (PubMed:7622483). Cleaves lysyl oxidase LOX at a site downstream of its propeptide cleavage site to produce a short LOX form with reduced collagen-binding activity (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 7
Locus Not Available
SNPs ADAMTS2
Gene Sequence
>3618 bp
ATGGATCCGCCGGCGGGAGCCGCCGGCCGCCTGCTCTGCCCCGCGCTGTTGCTGCTCCTG
CTGCTGCCGCTGCCCGCGGACGCCCGGCTCGCCGCCGCTGCCGCCGACCCCCCAGGCGGG
CCCCAGGGGCACGGAGCCGAGCGCATCCTGGCGGTGCCGGTGCGCACTGACGCCCAGGGC
CGCTTGGTGTCCCACGTGGTGTCGGCGGCGACGGCCCCAGCTGGGGTGCGGACCCGCAGG
GCCGCCCCTGCCCAGATCCCGGGGCTCTCTGGAGGCAGCGAGGAGGACCCCGGTGGCCGC
CTCTTCTACAATGTTACGGTGTTTGGCCGAGACCTGCACCTGCGGCTGCGGCCCAACGCC
CGCCTCGTGGCGCCTGGGGCCACGGTGGAGTGGCAGGGAGAATCGGGTGCCACCCGCGTG
GAGCCCCTGCTTGGGACCTGCCTCTACGTCGGAGACGTCGCGGGCCTGGCTGAATCCTCT
TCCGTGGCGCTCAGCAACTGCGATGGGCTGGCTGGCCTGATCCGTATGGAAGAGGAGGAA
TTCTTTATTGAGCCCCTGGAGAAAGGTCTGGCGGCGAAGGAGGCCGAACAGGGCCGTGTA
CACGTGGTGTATCATCGACCGACCACCTCCAGACCCCCTCCTCTGGGGGGGCCACAGGCC
CTGGACACAGGGATCTCCGCAGACAGCCTGGACAGCCTCAGCCGTGCTCTGGGTGTTCTG
GAGGAGCGAGTCAACAGCTCCAGGCGGAGGATGCGCAGGCATGCTGCCGACGACGACTAC
AACATCGAGGTCCTGCTTGGGGTGGACGACTCTGTGGTCCAGTTCCACGGGACGGAGCAC
GTGCAGAAGTACCTGCTCACCCTCATGAACATTGTCAACGAAATCTATCACGATGAGTCC
TTGGGGGCCCACATCAATGTCGTCCTGGTGCGGATAATCCTGCTGAGCTACGGGAAGTCC
ATGAGTCTCATTGAGATTGGGAACCCCTCTCAAAGTCTGGAGAATGTTTGCCGCTGGGCC
TACCTCCAGCAGAAGCCAGACACTGATCACGACGAGTACCACGATCACGCCATATTCCTC
ACACGGCAGGACTTCGGGCCCTCGGGCATGCAAGGCTATGCTCCTGTCACTGGGATGTGC
CACCCCGTCCGCAGCTGCACGCTGAACCACGAGGACGGCTTCTCCTCTGCGTTCGTGGTG
GCCCACGAGACTGGCCATGTGCTGGGCATGGAGCATGATGGGCAGGGCAACCGCTGCGGT
GACGAGGTGCGGCTGGGCAGCATCATGGCGCCCCTGGTGCAGGCAGCCTTCCATCGCTTC
CACTGGTCCCGCTGCAGCCAGCAGGAGCTGAGCCGCTACCTGCACTCCTATGACTGCCTG
CGGGATGACCCCTTCACCCACGACTGGCCGGCGCTGCCCCAGCTCCCCGGGCTGCACTAC
TCCATGAACGAGCAGTGCCGTTTCGACTTTGGCCTTGGTTACATGATGTGTACCGCGTTC
CGGACCTTCGACCCGTGCAAACAGCTGTGGTGCAGCCACCCTGACAACCCCTACTTTTGC
AAGACAAAGAAGGGGCCACCCCTGGATGGGACCATGTGTGCGCCTGGCAAGCACTGCTTT
AAAGGACACTGCATCTGGCTGACACCTGACATTCTCAAACGAGATGGCAACTGGGGTGCC
TGGAGTCCCTTCGGCTCCTGCTCGCGTACCTGCGGCACAGGTGTGAAGTTCAGGACCCGT
CAGTGCGACAACCCACACCCAGCCAATGGGGGCCGCACATGCTCGGGCCTCGCCTACGAT
TTCCAGCTCTGCAACTCGCAGGACTGCCCTGACGCGCTGGCCGACTTCCGCGAGGAGCAG
TGCCGGCAGTGGGACCTGTACTTCGAGCATGGTGACGCTCAACACCACTGGCTGCCCCAC
GAGCACCGGGACGCCAAGGAGCGGTGTCATCTCTACTGTGAGTCCAAGGAGACCGGGGAG
GTGGTGTCCATGAAGCGTATGGTGCATGACGGGACACGCTGTTCCTACAAGGACGCCTTC
AGCCTCTGCGTGCGTGGGGACTGCAGGAAGGTGGGCTGTGACGGGGTGATCGGCTCCAGC
AAGCAGGAGGACAAGTGTGGTGTGTGCGGAGGGGACAACTCCCACTGCAAGGTGGTCAAG
GGCACGTTCTCGCGCTCGCCCAAGAAGCTTGGTTACATCAAGATGTTTGAGATCCCGGCA
GGAGCCAGACACCTGCTAATCCAGGAAGCAGACACCACCAGCCATCACCTGGCCGTCAAA
AACCTGGAGACAGGCAAGTTCATTTTAAATGAGGAGAATGACGTGGATCCCAACTCCAAG
ACCTTCATCGCCATGGGCGTGGAGTGGGAGTACCGGGATGAGGACGGCCGGGAGACGCTG
CAGACCATGGGCCCCCTCCACGGCACCATCACTGTGCTGGTCATCCCAGAGGGGGACGCC
CGCATCTCACTGACCTACAAGTACATGATCCATGAGGACTCGCTCAATGTGGATGACAAC
AACGTCCTGGAAGACGACTCTGTGGGCTATGAGTGGGCCCTGAAGAAGTGGTCGCCCTGC
TCCAAGCCCTGCGGTGGAGGGTCCCAATTCACCAAGTATGGCTGCCGCCGGAGGCTGGAC
CACAAGATGGTGCACCGAGGCTTCTGCGACTCCGTCTCAAAGCCCAAAGCCATCCGCCGG
ACCTGCAACCCACAGGAGTGCTCCCAGCCCGTGTGGGTCACGGGTGAGTGGGAGCCGTGC
AGCCGGAGCTGTGGGCGGACAGGCATGCAGGTTCGCTCTGTGCGCTGTGTTCAGCCTCTG
CACAACAACACCACCCGCTCCGTGCACACCAAGCACTGCAATGACGCTCGACCCGAGGGC
CGCCGGGCCTGCAACCGCGAGCTGTGCCCTGGCCGGTGGCGGGCTGGATCCTGGTCCCAG
TGCTCAGTAACCTGTGGAAACGGCACCCAGGAACGGCCAGTGCTCTGCCGAACTGCGGAC
GACAGTTTCGGGGTGTGCCGGGAGGAGCGGCCTGAGACGGCAAGGATCTGCAGGCTTGGC
CCCTGTCCCCGAAACACCTCTGACCCCTCCAAGAAGAGCTACGTGGTCCAGTGGCTATCC
CGACCGGACCCCAACTCGCCAGTCCAGGAGACCTCGTCAAAGGGCCGCTGCCAAGGTGAC
AAGTCAGTGTTCTGTAGGATGGAAGTCTTGTCTCGTTATTGCTCCATCCCAGGCTACAAT
AAGCTGTGCTGCAAGTCCTGTAACCCGCACGACAACCTCACTGATGTGGACGACAGGGCA
GAGCCACCCTCTGGGAAGCACAATGACATTGAAGAGCTCATGCCCACCCTTTCAGTGCCC
ACTCTAGTCATGGAGGTGCAGCCTCCGCCAGGCATACCCCTGGAGGTGCCTCTCAATACT
TCCAGCACCAATGCCACCGAGGACCATCCAGAAACCAATGCTGTGGATGTGCCCTACAAA
ATCCCTGGCCTGGAAGATGAAGTCCAGCCACCCAACCTGATCCCTCGACGACCGAGCCCA
TATGAAAAGACCAGAAACCAAAGAATCCAAGAGCTCATTGATGAGATGAGGAAGAAAGAG
ATGCTCGGAAAGTTCTAA
Protein Properties
Number of Residues 1205
Molecular Weight 133888.0
Theoretical pI 6.8
Pfam Domain Function Not Available
Signals
  • 1-28
Transmembrane Regions Not Available
Protein Sequence
>A disintegrin and metalloproteinase with thrombospondin motifs 2
MDPPAGAAGRLLCPALLLLLLLPLPADARLAAAAADPPGGPQGHGAERILAVPVRTDAQG
RLVSHVVSAATAPAGVRTRRAAPAQIPGLSGGSEEDPGGRLFYNVTVFGRDLHLRLRPNA
RLVAPGATVEWQGESGATRVEPLLGTCLYVGDVAGLAESSSVALSNCDGLAGLIRMEEEE
FFIEPLEKGLAAKEAEQGRVHVVYHRPTTSRPPPLGGPQALDTGISADSLDSLSRALGVL
EERVNSSRRRMRRHAADDDYNIEVLLGVDDSVVQFHGTEHVQKYLLTLMNIVNEIYHDES
LGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTDHDEYHDHAIFL
TRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCG
DEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLRDDPFTHDWPALPQLPGLHY
SMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAPGKHCF
KGHCIWLTPDILKRDGNWGAWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTCSGLAYD
FQLCNSQDCPDALADFREEQCRQWDLYFEHGDAQHHWLPHEHRDAKERCHLYCESKETGE
VVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCDGVIGSSKQEDKCGVCGGDNSHCKVVK
GTFSRSPKKLGYIKMFEIPAGARHLLIQEADTTSHHLAVKNLETGKFILNEENDVDPNSK
TFIAMGVEWEYRDEDGRETLQTMGPLHGTITVLVIPEGDARISLTYKYMIHEDSLNVDDN
NVLEDDSVGYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKMVHRGFCDSVSKPKAIRR
TCNPQECSQPVWVTGEWEPCSRSCGRTGMQVRSVRCVQPLHNNTTRSVHTKHCNDARPEG
RRACNRELCPGRWRAGSWSQCSVTCGNGTQERPVLCRTADDSFGVCREERPETARICRLG
PCPRNTSDPSKKSYVVQWLSRPDPNSPVQETSSKGRCQGDKSVFCRMEVLSRYCSIPGYN
KLCCKSCNPHDNLTDVDDRAEPPSGKHNDIEELMPTLSVPTLVMEVQPPPGIPLEVPLNT
SSTNATEDHPETNAVDVPYKIPGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKE
MLGKF
GenBank ID Protein CAA65253.1
UniProtKB/Swiss-Prot ID P79331
UniProtKB/Swiss-Prot Entry Name ATS2_BOVIN
PDB IDs Not Available
GenBank Gene ID X96389
GeneCard ID ADAMTS2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available