Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01074
Secondary Accession Numbers None
Name Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
Synonyms Not Available
Gene Name PDHA1
Protein Type Enzyme
Biological Properties
General Function Energy production and conversion
Specific Function The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle.
Pathways
  • Citric Acid Cycle
  • Pyruvate Metabolism
  • Transfer of Acetyl Groups into Mitochondria
  • Warburg Effect
Reactions
Pyruvic acid + Coenzyme A + NAD → Acetyl-CoA + Carbon dioxide + NADH details
Pyruvic acid + Lipoamide → S-Acetyldihydrolipoamide-E + Carbon dioxide details
Pyruvic acid → Acetyl-CoA details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location X
Locus Not Available
SNPs PDHA1
Gene Sequence
>1173 bp
ATGAGGAAGATGCTCGCCGCCGTCTCTCGCGTGTTGTCGGGCGTCGCCCAGAAGCCGGCA
AGCAGAGTGCTGGTGGCATCTCGTCATTTTGCAAATGATGCTACTTTTGAAATTAAGAAA
TGTGATCTTCACCGGCTGGAAGAGGGCCCTCCTGTCACTACAGTGCTTACCAGGGAGGAT
GGGCTCAAATACTACAGGATGATGCAGACCGTTCGCCGAATGGAGTTAAAAGCAGATCAG
CTGTATAAACAGAAAATTATTCGTGGTTTCTGTCACTTGTGTGATGGTCAGGAAGCTTGT
TGTGTAGGCCTGGAGGCCGGCATCAACCCCACAGACCATCTGATCACAGCGTACCGGGCT
CATGGCTTTACCTTTACTCGTGGACTCTCTGTCCGGGAGATCCTTGCAGAGCTTACAGGA
CGAAGAGGTGGTTGTGCTAAAGGAAAAGGAGGATCAATGCATATGTATGCCAAGAATTTC
TACGGAGGCAATGGCATCGTGGGAGCTCAGGTGCCCCTGGGAGCTGGGATTGCTCTGGCC
TGTAAGTATAATGGAAAAGACGAGGTCTGTTTGACTTTGTACGGTGATGGCGCTGCTAAT
CAGGGTCAGATATTCGAAGCTTACAATATGGCAGCTTTGTGGAAATTGCCTTGTATTTTC
ATCTGTGAGAATAACCGCTATGGGATGGGAACATCTGTGGAAAGAGCAGCAGCCAGCACT
GATTACTACAAGAGAGGCGACTTTATTCCTGGGCTGAGGGTAGATGGAATGGATATCCTG
TGTGTCCGGGAGGCCACAAAATTTGCAGCTGCCTATTGTAGATCTGGAAAGGGGCCTATA
CTGATGGAGCTGCAGACTTACCGTTACCATGGACACAGCATGAGTGATCCTGGAGTGAGT
TACCGTACCCGAGAAGAGATTCAGGAAGTTAGAAGTAAGAGTGACCCTATCATGCTCCTC
AAGGACAGGATGGTGAACAGCAATCTCGCCAGTGTTGAAGAACTAAAGGAAATTGATGTG
GAAGTGAGAAAAGAAATTGAGGATGCTGCTCAGTTTGCTACTGCTGATCCTGAACCACCT
TTGGAAGAACTCGGCTATCACATTTACTGCAACGATCCACCTTTTGAAGTCCGGGGTGCA
AACCAGTGGATCAAGTTTAAGTCCATCAGTTAA
Protein Properties
Number of Residues 390
Molecular Weight 43388.0
Theoretical pI 8.11
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
MRKMLAAVSRVLSGVAQKPASRVLVASRHFANDATFEIKKCDLHRLEEGPPVTTVLTRED
GLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRA
HGFTFTRGLSVREILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALA
CKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAAST
DYYKRGDFIPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS
YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPP
LEELGYHIYCNDPPFEVRGANQWIKFKSIS
GenBank ID Protein AAI51314.1
UniProtKB/Swiss-Prot ID A7MB35
UniProtKB/Swiss-Prot Entry Name ODPA_BOVIN
PDB IDs
GenBank Gene ID BC151313
GeneCard ID PDHA1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available