Showing Protein Sodium/potassium-transporting ATPase alpha-3 chain (BMDBP01089)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01089 |
| Secondary Accession Numbers | None |
| Name | Sodium/potassium-transporting ATPase alpha-3 chain |
| Synonyms | Not Available |
| Gene Name | atp1A3 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Inorganic ion transport and metabolism |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 18 |
| Locus | Not Available |
| SNPs | atp1A3 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 171 |
| Molecular Weight | 19015.0 |
| Theoretical pI | 6.51 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Sodium/potassium-transporting ATPase alpha-3 chain DKKDDKDSPKKSKGTKDRRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEI LARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLY LGIVLAAVVIITGCFPYYQEAKSSKIMESSKNMVPQQALVIREGEKMQVNA |
| External Links | |
| GenBank ID Protein | CAD42966.1 |
| UniProtKB/Swiss-Prot ID | Q8HYW6 |
| UniProtKB/Swiss-Prot Entry Name | Q8HYW6_BOVIN |
| PDB IDs | |
| GenBank Gene ID | AJ496458 |
| GeneCard ID | atp1A3 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |