Showing Protein Ornithine decarboxylase antizyme 1 (BMDBP01140)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01140 |
| Secondary Accession Numbers | None |
| Name | Ornithine decarboxylase antizyme 1 |
| Synonyms | Not Available |
| Gene Name | OAZ1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in ornithine decarboxylase inhibitor activity |
| Specific Function | Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome. Triggers ODC degradation by inducing the exposure of a cryptic proteasome-interacting surface of ODC. Stabilizes AZIN2 by interfering with its ubiquitination. Also inhibits cellular uptake of polyamines by inactivating the polyamine uptake transporter. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. Involved in the translocation of AZIN2 from ER-Golgi intermediate compartment (ERGIC) to the cytosol. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 7 |
| Locus | Not Available |
| SNPs | OAZ1 |
| Gene Sequence |
>207 bp ATGGTGAAATCCTCCCTGCAGCGGATCCTCAACAGCCACTGCTTCGCCAGAGAGAAGGAA GGGGATAAACCCAGCGCCACCGTCCACGCCACCCGCACCATGCCGCTCCTTAGCCTGCAC AGCCGCGGAGGCCGCAGCAGTGAGAGTTCCAGGGTCTCCATCAACTGCTGTAGTAACCTG GGTCCAGGGCCTCGGTGGTGCTCCTGA |
| Protein Properties | |
| Number of Residues | 227 |
| Molecular Weight | 25448.0 |
| Theoretical pI | 8.09 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Ornithine decarboxylase antizyme MVKSSLQRILNSHCFAREKEGDKPSATVHATRTMPLLSLHSRGGRSSESSRVSINCCSNL GPGPRWCSDVPHPPLKIPGGRGNSQRDHNLSANLFYSDNRLNVTEELTSNNKTRIFNVQS RLTEAKHINWRAVLSNSCLYVEIPGGALPEGSKDSFAVLLEFAEEQLHVDHVFICFHKNR DDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFERESSGEEE |
| External Links | |
| GenBank ID Protein | AAW82083.1 |
| UniProtKB/Swiss-Prot ID | Q56K12 |
| UniProtKB/Swiss-Prot Entry Name | OAZ1_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AY911315 |
| GeneCard ID | OAZ1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |