Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01219
Secondary Accession Numbers None
Name UMP-CMP kinase
Synonyms Not Available
Gene Name CMPK1
Protein Type Enzyme
Biological Properties
General Function Nucleotide transport and metabolism
Specific Function Catalyzes the phosphorylation of pyrimidine nucleoside monophosphates at the expense of ATP. Plays an important role in de novo pyrimidine nucleotide biosynthesis. Has preference for UMP and CMP as phosphate acceptors. Also displays broad nucleoside diphosphate kinase activity.
Pathways
  • Lactose Synthesis
Reactions
Adenosine triphosphate + Uridine 5'-monophosphate → ADP + Uridine 5'-diphosphate details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus Not Available
SNPs CMPK1
Gene Sequence
>687 bp
ATGCTTAACCGCTGCGGCCGCCGGCTGCTGCACGTCCTAGGCCTTAGCTTTCCGCTGCTG
ACCGGCCGGCCACTTTTCCTCTTCCCGCATCGCTTCATGAAGCCGCAGGTCGTGTTCGTT
CTTGGCGGTCCCGGCGCCGGCAAGGGGACCCAGTGCGCCCGCATCGTTGAGAAATATGGC
TACACACACCTTTCTGCAGGAGAACTTCTCCGTGATGAAAGGAAAAACCCAGATTCACAG
TATGGTGAACTCATTGAAAAGTACATTAAAGATGGAAAGATTGTGCCAGTTGAGATAACC
ATCAGTTTGTTAAGGAGGGAAATGGATCAGACAATGGCAGCCAATGCTCAGAAGAATAAA
TTCTTGATTGATGGGTTTCCAAGAAATCAGGACAACCTTCAAGGCTGGAATAAGACCATG
GATGGGAAAGCTGATGTATCTTTTGTTTTATTTTTTGACTGTAATAATGAGATCTGTATT
GAACGATGTCTTGAGAGGGGAAAGAGTAGTGGTAGAAGTGATGACAACAGAGAGAGCTTG
GAAAAGAGAATTCAAACCTATCTTCAGTCAACAAAGCCAATTATTGACTTGTATGAAGAA
ATGGGGAAAGTCAGGAAAATAGATGCTTCTAAATCTGTTGATGAAGTTTTTGATGAAGTT
GTGAAGATTTTTGACAAAGAAGGCTAA
Protein Properties
Number of Residues 196
Molecular Weight 22279.0
Theoretical pI 5.48
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>UMP-CMP kinase
MKPQVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKDG
KIVPVEITISLLRREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFF
DCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVRKIDASKS
VDEVFDEVVKIFDKEG
GenBank ID Protein AAI12479.1
UniProtKB/Swiss-Prot ID Q2KIW9
UniProtKB/Swiss-Prot Entry Name KCY_BOVIN
PDB IDs
GenBank Gene ID BC112478
GeneCard ID CMPK1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available