Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01229
Secondary Accession Numbers None
Name 6-phosphogluconolactonase
Synonyms Not Available
Gene Name PGLS
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function Hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.
Pathways
  • Carbohydrate degradation
  • D-ribulose 5-phosphate from D-glucose 6-phosphate (oxidative stage): step 2/3
  • Pentose Phosphate Pathway
  • Warburg Effect
Reactions
Gluconolactone + Water → 6-Phosphogluconic acid details
6-Phosphonoglucono-D-lactone + Water → 6-Phosphogluconic acid + Hydrogen details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 7
Locus Not Available
SNPs PGLS
Gene Sequence
>777 bp
ATGGCCGCGCCGGCCCCCCGCCTCATCTCTGTCTTCTCGAGCCCGCAGGAGCTGGGTGCG
TCTTTGGCGCAACTGGTAGTACAGCAGGCAGCATGCTGCCTGGCGGATGCCGGCGCCCGC
TTCACGCTCGGCTTGTCCGGCGGCAGCCTTGTCTCCATGCTAGCCCGCGAGCTGCCCGCT
GCCGCCGCCCCCGCTGGACCCGCTAGCCTCGCGCGCTGGACGCTGGGCTTCTGCGACGAG
CGCCTTGTGCCCTTCGAGCACGCCGAGAGCACGTACGGCCTGTACCGGACCCACCTGCTC
TCCAAGCTCCCTATCTTCGACAGCCAGGTGATCACCATCAACCCTGCATTGCCTGTGGAG
GAGGCGGCTGAGGACTACGCCAAGAAGCTGAGACAGGCCTTCCAAGGGGACTCCATCCCG
GTTTTTGACCTGCTGATTCTGGGTGTGGGTCCTGATGGCCACACCTGCTCACTCTTCCCA
GACCACCCCCTCCTGCAGGAGCGGGAGAAAATTGTGGCCCCCATCAGTGACTCTCCGAAA
CCACCTCCGCAGCGCGTGACCCTCACTCTTCCCGTGCTGAACGCAGCTCGAACGGTCATC
TATGTGGCGACAGGAGAAGGCAAGGCAGCTATTCTGAAGCGCATTTTGGAGGACAAGGAG
GAGAACCCACTCCCCGCCGCACTGGTTCAGCCCAGCGCTGGGAAACTTTGCTGGTTTCTG
GACGAGGCAGCAGCCCGACTCCTGACCGTGCCCTTCGAGAAGCATTCCACTTTGTAA
Protein Properties
Number of Residues 258
Molecular Weight 27547.0
Theoretical pI 5.65
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>6-phosphogluconolactonase
MAAPAPRLISVFSSPQELGASLAQLVVQQAACCLADAGARFTLGLSGGSLVSMLARELPA
AAAPAGPASLARWTLGFCDERLVPFEHAESTYGLYRTHLLSKLPIFDSQVITINPALPVE
EAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPK
PPPQRVTLTLPVLNAARTVIYVATGEGKAAILKRILEDKEENPLPAALVQPSAGKLCWFL
DEAAARLLTVPFEKHSTL
GenBank ID Protein AAI09790.1
UniProtKB/Swiss-Prot ID Q2TBQ8
UniProtKB/Swiss-Prot Entry Name 6PGL_BOVIN
PDB IDs Not Available
GenBank Gene ID BC109789
GeneCard ID PGLS
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available