You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01234
Secondary Accession Numbers None
Name Reelin
Synonyms Not Available
Gene Name RELN
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function Extracellular matrix serine protease that plays a role in layering of neurons in the cerebral cortex and cerebellum. Regulates microtubule function in neurons and neuronal migration. Affects migration of sympathetic preganglionic neurons in the spinal cord, where it seems to act as a barrier to neuronal migration. Enzymatic activity is important for the modulation of cell adhesion. Binding to the extracellular domains of lipoprotein receptors VLDLR and LRP8/APOER2 induces tyrosine phosphorylation of DAB1 and modulation of TAU phosphorylation (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs RELN
Gene Sequence Not Available
Protein Properties
Number of Residues 52
Molecular Weight 6069.0
Theoretical pI 3.79
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Reelin
ENVQFQWKQENLQVGEVYEACWALDNILIINSAHRQVVLEDNLDPVDTGNWL
GenBank ID Protein AAF64286.1
UniProtKB/Swiss-Prot ID Q9N117
UniProtKB/Swiss-Prot Entry Name RELN_BOVIN
PDB IDs Not Available
GenBank Gene ID AF232904
GeneCard ID RELN
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available