You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein Reelin (BMDBP01234)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01234 |
| Secondary Accession Numbers | None |
| Name | Reelin |
| Synonyms | Not Available |
| Gene Name | RELN |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in calcium ion binding |
| Specific Function | Extracellular matrix serine protease that plays a role in layering of neurons in the cerebral cortex and cerebellum. Regulates microtubule function in neurons and neuronal migration. Affects migration of sympathetic preganglionic neurons in the spinal cord, where it seems to act as a barrier to neuronal migration. Enzymatic activity is important for the modulation of cell adhesion. Binding to the extracellular domains of lipoprotein receptors VLDLR and LRP8/APOER2 induces tyrosine phosphorylation of DAB1 and modulation of TAU phosphorylation (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | RELN |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 52 |
| Molecular Weight | 6069.0 |
| Theoretical pI | 3.79 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Reelin ENVQFQWKQENLQVGEVYEACWALDNILIINSAHRQVVLEDNLDPVDTGNWL |
| External Links | |
| GenBank ID Protein | AAF64286.1 |
| UniProtKB/Swiss-Prot ID | Q9N117 |
| UniProtKB/Swiss-Prot Entry Name | RELN_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AF232904 |
| GeneCard ID | RELN |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |