Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01304
Secondary Accession Numbers
  • BMDBP03101
Name Alpha-lactalbumin
Synonyms Not Available
Gene Name LALBA
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.
Pathways Not Available
Reactions
D-Glucose + Uridine diphosphategalactose → Uridine 5'-diphosphate + Alpha-Lactose details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q21
SNPs LALBA
Gene Sequence
>429 bp
AMOFALUISITE.TAACCAAAATGATGTCCTTTGTCTCTCTGCTCCTGGTAGGCATCCTA
TTCCATGCCACCCAGGCTGAACAGTTAACAAAATGTGAGGTGTTCCGGGAGCTGAAAGAC
TTGAAGGGCTACGGAGGTGTCAGTTTGCCTGAATGGGTCTGTACCACGTTTCATACCAGT
GGTTATGACACACAAGCCATAGTACAAAACAATGACAGCACAGAATATGGACTCTTCCAG
ATAAATAATAAAATTTGGTGCAAAGACGACCAGAACCCTCACTCAAGCAACATCTGTAAC
ATCTCCTGTGACAAGTTCCTGGATGATGATCTTACTGATGACATTATGTGTGTCAAGAAG
ATTCTGGATAAAGTAGGAATTAACTACTGGTTGGCCCATAAAGCACTCTGTTCTGAGAAG
CTGGATCAG
Protein Properties
Number of Residues 142
Molecular Weight 16247.0
Theoretical pI 4.73
Pfam Domain Function Not Available
Signals
  • 1-19
Transmembrane Regions Not Available
Protein Sequence
>Alpha-lactalbumin
MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAI
VQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGI
NYWLAHKALCSEKLDQWLCEKL
GenBank ID Protein CAA29664.1
UniProtKB/Swiss-Prot ID P00711
UniProtKB/Swiss-Prot Entry Name LALBA_BOVIN
PDB IDs
GenBank Gene ID X06366
GeneCard ID LALBA
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available