Showing Protein Guanylyl cyclase-activating protein 2 (BMDBP01311)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01311 |
| Secondary Accession Numbers | None |
| Name | Guanylyl cyclase-activating protein 2 |
| Synonyms | Not Available |
| Gene Name | GUCA1B |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in calcium ion binding |
| Specific Function | Stimulates two retinal guanylyl cyclases (GCs) GUCY2D and GUCY2F when free calcium ions concentration is low, and inhibits GUCY2D and GUCY2F when free calcium ions concentration is elevated (PubMed:7665624). This Ca(2+)-sensitive regulation of GCs is a key event in recovery of the dark state of rod photoreceptors following light exposure (PubMed:9651312). May be involved in cone photoreceptor response and recovery of response in bright light (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 23 |
| Locus | Not Available |
| SNPs | GUCA1B |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 204 |
| Molecular Weight | 23728.0 |
| Theoretical pI | 4.47 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Guanylyl cyclase-activating protein 2 MGQQFSWEEAEENGAVGAADAAQLQEWYKKFLEECPSGTLFMHEFKRFFKVPDNEEATQY VEAMFRAFDTNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRQELLDI VESIYKLKKACSVEVEAEQQGKLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWV MKMLQMDLNPSSWISQQRRKSAMF |
| External Links | |
| GenBank ID Protein | AAC48478.1 |
| UniProtKB/Swiss-Prot ID | P51177 |
| UniProtKB/Swiss-Prot Entry Name | GUC1B_BOVIN |
| PDB IDs | |
| GenBank Gene ID | U32856 |
| GeneCard ID | GUCA1B |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |