Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01327
Secondary Accession Numbers None
Name Ornithine aminotransferase, mitochondrial
Synonyms Not Available
Gene Name OAT
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Not Available
Pathways
  • Amino-acid biosynthesis
  • Arginine and Proline Metabolism
  • L-glutamate 5-semialdehyde from L-ornithine: step 1/1
  • L-proline biosynthesis
Reactions
Ornithine + Oxoglutaric acid → L-Glutamic-gamma-semialdehyde + L-Glutamic acid details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 26
Locus Not Available
SNPs OAT
Gene Sequence
>1320 bp
ATGCTTTCCAAACTAGCGCGTTTGCAGACTGTTGCTGGCCTTGGTCTTGGAGTTCATTCT
TCAGTGGCTTCTGCTACATCTGTTGCAACTAAAAAAACCGTTCAAGGCCCTCCGTCCTCT
GATTACATTTTTGAACGGGAATCTAAATATGGTGCCCACAACTACCATCCTTTACCTGTA
GCCCTGGAGAGAGGGAAGGGCATTTACGTATGGGATGTTGAAGGCAGAAAATATTTTGAC
TTTCTGAGTGCTTACAGTGCTGTCAACCAGGGGCATTGTCATCCAAAGATTGTGGATGCT
TTGAAAAGTCAAGTGGACAAGTTGACCTTAACATCTAGGGCTTTCTACAATAACGTGCTT
GGTGAATATGAAGAGTATGTTACTAAACTTTTCAACTACCACAAAGTTCTTCCTATGAAT
ACAGGAGTGGAGGCTGGAGAGACTGCTTGCAAGCTTGCTCGTAAATGGGGGTATACTGTC
AAGGGGATCCCGAAATACAAAGCAAAGATTGTTTTTGCAGCTGGGAACTTCTGGGGTAGG
ACATTGTCTGCTATCTCCAGCTCCACTGACCCAACCAGTTACGATGGTTTTGGACCATTT
ATGCCGGGTTTTGAAATCATTCCGTATAATGATCTGCCTGCCCTTGAGCGTGCGCTTCAG
GACCCAAACGTTGCCGCGTTCATGGTGGAACCAATCCAGGGTGAAGCGGGCGTTGTTGTT
CCGGATCCAGGCTACCTCGTGGGCGTCCGCGAGCTCTGCACCCAGCACCAGGTTCTGTTT
ATTGCTGATGAAATCCAGACAGGCTTGGCCAGAACTGGGAGATGGCTGGCTATTGACCAC
GAAAATGTCCGACCTGATATTGTCCTTCTAGGAAAGGCACTTTCTGGTGGTTTATACCCC
GTGTCCGCAGTGTTGTGTGATGATGAAATAATGCTGACCATTAAGCCAGGGGAACATGGT
TCTACGTATGGAGGCAATCCGCTGGGCTGCCGAGTGGCTATCGCAGCCCTGGAGGTTTTG
GAAGAAGAAAACCTTGCTGAAAATGCAGAGAAAATGGGTATCATCTTGAGAAATGAACTC
ATGAAGCTGCCTTCTGATGTTGTAACGACTGTAAGAGGAAAAGGATTACTAAATGCTATT
GTTATCAGAGAAACCAAAGATTGTGATGCTTGGAAGGTGTGTCTGCGACTGCGAGATAAT
GGACTTCTGGCCAAGCCAACCCACGGCGACATCATTAGGTTTGCGCCCCCGCTTGTGATC
AAGGAGGATGAGATTCTAGAGGCGGTGGAGATCATTAACAAGACCATCCTGTCTTTCTGA
Protein Properties
Number of Residues 439
Molecular Weight 48075.0
Theoretical pI 6.51
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Ornithine aminotransferase, mitochondrial
MLSKLARLQTVAGLGLGVHSSVASATSVATKKTVQGPPSSDYIFERESKYGAHNYHPLPV
ALERGKGIYVWDVEGRKYFDFLSAYSAVNQGHCHPKIVDALKSQVDKLTLTSRAFYNNVL
GEYEEYVTKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIPKYKAKIVFAAGNFWGR
TLSAISSSTDPTSYDGFGPFMPGFEIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVV
PDPGYLVGVRELCTQHQVLFIADEIQTGLARTGRWLAIDHENVRPDIVLLGKALSGGLYP
VSAVLCDDEIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENAEKMGIILRNEL
MKLPSDVVTTVRGKGLLNAIVIRETKDCDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI
KEDEILEAVEIINKTILSF
GenBank ID Protein AAI02428.1
UniProtKB/Swiss-Prot ID Q3ZCF5
UniProtKB/Swiss-Prot Entry Name OAT_BOVIN
PDB IDs
GenBank Gene ID BC102427
GeneCard ID OAT
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available