Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01375
Secondary Accession Numbers None
Name SGPL1 protein
Synonyms Not Available
Gene Name SGPL1
Protein Type Enzyme
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Not Available
Pathways
  • Sphingolipid Metabolism
Reactions
Sphinganine 1-phosphate → O-Phosphoethanolamine + Palmitaldehyde details
Sphingosine 1-phosphate → O-Phosphoethanolamine + Palmitaldehyde details
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 28
Locus Not Available
SNPs SGPL1
Gene Sequence
>1707 bp
ATGCCCAGTGCAGACCTAATGTCGTTGAAGGCCTTTGAGCCCTACTTTGAGATTTTGGAA
GTATATTCCACAAAGGCCAAGAACTACGTGAATGGGCACTGTACCAAGTATGAGCCCTGG
CAGCTGATTGTGTGGAGTGTCGTGTGGACTCTGCTGATAGTCTGGGTGTATGAGTTTGTC
TTCCAGCCAGAGAGTTTATGGTCAAGGTTTAAGAAGAGATGTTTTAAGCTTATCCGGAAG
ATGCCTATCATTGGTCGTAAGATCCAAGATAAGTTGAACAAGACCAAGGAAGATATTAGC
AAGAGCATGACATTCCTGAAAGTGGACCAAGATTACGTGAAAGCCCTGCCCTCTCAAGGC
CTGAGCCCGGCTGCCGTTCTGGAGAAACTCAAAGAATACAGCTCGAAGGATGTCTTGTGG
CAAGAGGGGAAAGCCTCCGGAGCAGTGTATAGTGGGGAGAAGGAGCTCACCGACCTCCTC
GTGAAGGCTTATGGAGATTTCGCATGGAGTAATCCACTGCATCCAGACATCTTCCCCGGA
CTCCGGAAGATAGAGGCAGAGATTGTGAGGATGGCTTGTTCCCTATTCAATGGGGGACCA
GATTCCTGTGGATGTGTGACCTCTGGGGGGACAGAAAGTATTTTGATGGCCTGCAAAGCT
TATCGGGAACTAGCCTTCGAGAATGGGATCAAAACTCCAGAAATCGTAGCCCCCCAGAGT
GCCCACGCTGCATTTGACAAAGCCGCCAGTTACTTTGGGATGAAGATTATACGGGTTCCC
CTAAACAAAATGATGGAGGTGGATGTTCGGGCAATGCGCAGAGCCATCTCTAGGAATACG
GCCATGCTCGTCTGTTCTGCCCCACAGTTCCCTCATGGTGTGATAGACCCTATCCCTGAA
GTGGCCAAGCTGGCTGTCAAATACAAAATACCTCTTCATGTGGACGCTTGTCTGGGGGGC
TTCCTCATCGTCTTCATGGAGAAAGCGGGATACCCGCTGGAGCAGCCGTTTGATTTCCGG
GTGAAAGGCGTGACCAGCATTTCAGCTGATACTCATAAGTATGGCTACGCCCCCAAGGGC
TCTTCCGTGCTCTTGTACTCTGACAAGAAGTACAGGAGCTATCAGTTCTTCGTTGCCACA
GACTGGCAGGGCGGCATCTACGCTTCCCCAACCATTGCGGGCTCACGGCCTGGCGGCATC
AGCGCAGCCTGTTGGGCCTCCTTGATGTACTTCGGTGAGAGCGGCTACGTTGAAGCTACC
AAACAGATCATCAAAACCACTCGCTTCCTCAAGTCAGAACTAGAAAATATCAAAGGCATC
TTTGTCTTTGGGAATCCTCAGTTGTCAGTCATCGCTCTGGGCTCTCGTGATTTTGATATC
TATCGACTATTCAACCTGATGAATGCCAAGGGCTGGAACTTGAATCAGCTGCAGTTCCCA
CCCAGCCTTCATTTCTGCATCACATTGGTACACACCCGCAAGCGGGTAGCCATACAGTTC
CTTAAGGATATCCGGGAATCCGTCACTCAAATCATGAAGAATCCGAAAGCAAAGACCACA
GGAATGGGTGCGATCTATGGCATGGCCCAGGCTACCATCGACAGGAACCTGGTGGCGGAG
TTGTCCTCCGTCTTCTTGGACAGCCTTTTCAGTACAGACACTACAACTCAGGGCAGCCAG
ATGAATGGCTCTCCGAAACCCCGCTGA
Protein Properties
Number of Residues 568
Molecular Weight 63567.0
Theoretical pI 9.57
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 42-61
Protein Sequence
>SGPL1 protein
MPSADLMSLKAFEPYFEILEVYSTKAKNYVNGHCTKYEPWQLIVWSVVWTLLIVWVYEFV
FQPESLWSRFKKRCFKLIRKMPIIGRKIQDKLNKTKEDISKSMTFLKVDQDYVKALPSQG
LSPAAVLEKLKEYSSKDVLWQEGKASGAVYSGEKELTDLLVKAYGDFAWSNPLHPDIFPG
LRKIEAEIVRMACSLFNGGPDSCGCVTSGGTESILMACKAYRELAFENGIKTPEIVAPQS
AHAAFDKAASYFGMKIIRVPLNKMMEVDVRAMRRAISRNTAMLVCSAPQFPHGVIDPIPE
VAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEQPFDFRVKGVTSISADTHKYGYAPKG
SSVLLYSDKKYRSYQFFVATDWQGGIYASPTIAGSRPGGISAACWASLMYFGESGYVEAT
KQIIKTTRFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLFNLMNAKGWNLNQLQFP
PSLHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQATIDRNLVAE
LSSVFLDSLFSTDTTTQGSQMNGSPKPR
GenBank ID Protein AAI40469.1
UniProtKB/Swiss-Prot ID A5D788
UniProtKB/Swiss-Prot Entry Name A5D788_BOVIN
PDB IDs Not Available
GenBank Gene ID BC140468
GeneCard ID SGPL1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available