Showing Protein Histidine-rich glycoprotein (BMDBP01380)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01380 |
| Secondary Accession Numbers | None |
| Name | Histidine-rich glycoprotein |
| Synonyms | Not Available |
| Gene Name | HRG |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Inorganic ion transport and metabolism |
| Specific Function | Plasma glycoprotein that binds a number of ligands such as heme, heparin, heparan sulfate, thrombospondin, plasminogen, and divalent metal ions. Inhibits rosette formation. Acts as an adapter protein and implicated in regulating many processes such as immune complex and pathogen clearance, cell adhesion, angiogenesis, coagulation and fibrinolysis. Mediates clearance of necrotic cells through enhancing the phagocytosis of necrotic cells in a heparan sulfate-dependent pathway. This process can be regulated by the presence of certain HRG ligands such as heparin and zinc ions. Binds to IgG subclasses of immunoglobins containing kappa and lambda light chains with different affinities regulating their clearance and inhibiting the formation of insoluble immune complexes. Tethers plasminogen to the cell surface. Binds T-cells and alters the cell morphology. Modulates angiogenesis by blocking the CD6-mediated antiangiongenic effect of thrombospondins, THBS1 and THBS2 (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 1 |
| Locus | Not Available |
| SNPs | HRG |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 396 |
| Molecular Weight | 44471.0 |
| Theoretical pI | 7.47 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Histidine-rich glycoprotein AVNPTGCDAVEPVAVRALDLINKGRDGYLFQLLRVADAHLDKVESIAVYYLVESDCPVLS RKHWDDCELNVTVIGQCKLAGPEDLSVNDFNCTTSSVSSALTNMRARGGEGTSYFLDFSV RNCSSHHFPRHHIFGFCRADLFYDVEASDLETPKDIVTNCEVFHRRFSAVQHHLGRPFHS GEHEHSPAGRPPFKPSGSKDHGHPHESYNFRCPPPLEHKNHSDSPPFQARAPLPFPPPGL RCPHPPFGTKGNHRPPHDHSSDEHHPHGHHPHGHHPHGHHPHGHHPPDNDFYDHGPCDPP PHRPPPRHSKERGPGKGHFRFHWRPTGYIHRLPSLKKGEVLPLPEANFPSFSLPNHNNPL QPEIQAFPQSASESCPGTFNIKFLHISKFFAYTLPK |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | P33433 |
| UniProtKB/Swiss-Prot Entry Name | HRG_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | Not Available |
| GeneCard ID | HRG |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |