Showing Protein Monocyte chemotactic protein 1B (BMDBP01387)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01387 |
| Secondary Accession Numbers | None |
| Name | Monocyte chemotactic protein 1B |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in chemokine activity |
| Specific Function | Chemotactic factor that attracts monocytes, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 74 |
| Molecular Weight | 8363.0 |
| Theoretical pI | 9.98 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Monocyte chemotactic protein 1B DAINSPVTCCYTLTSKKISMQRLMSYRRVTSSKCPKEAVIFKTIAGKEICAEPKXXWVQD SISHLDKKNQXPKP |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | P80343 |
| UniProtKB/Swiss-Prot Entry Name | MCPB_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | Not Available |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |