Showing Protein Fibroblast growth factor 4 (BMDBP01388)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01388 |
| Secondary Accession Numbers | None |
| Name | Fibroblast growth factor 4 |
| Synonyms | Not Available |
| Gene Name | FGF4 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in growth factor activity |
| Specific Function | Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 29 |
| Locus | Not Available |
| SNPs | FGF4 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 206 |
| Molecular Weight | 22042.0 |
| Theoretical pI | 10.17 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Fibroblast growth factor 4 MAGPGTAAAALLPAVLLAVLAPWAGRGGAAPTAPNGTLEAELERRWESLVARSLLAGLPV AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTSDSLLELSP VERGVVSIFGVASRFFVAMSSRGRLYGSPFFTDECRFREILLPNNYNAYECDRHPGMFIA LSKNGKAKKGNRVSPTMKVTHFLPRL |
| External Links | |
| GenBank ID Protein | AAA91622.1 |
| UniProtKB/Swiss-Prot ID | P48803 |
| UniProtKB/Swiss-Prot Entry Name | FGF4_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | U15969 |
| GeneCard ID | FGF4 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |