Showing Protein Regakine-1 (BMDBP01400)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01400 |
| Secondary Accession Numbers | None |
| Name | Regakine-1 |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in chemokine activity |
| Specific Function | Chemotactic activity for neutrophils and lymphocytes. Binds to heparin. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 19 |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 92 |
| Molecular Weight | 10281.0 |
| Theoretical pI | 8.65 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Regakine-1 MRVSLAALAFLLTLAVLHSEANEEPAGNMRVCCFSSVTRKIPLSLVKNYERTGDKCPQEA VIFQTRSGRSICANPGQAWVQKYIEYLDQMSK |
| External Links | |
| GenBank ID Protein | CAC85743.1 |
| UniProtKB/Swiss-Prot ID | P82943 |
| UniProtKB/Swiss-Prot Entry Name | REG1_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AJ313203 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |