Identification
BMDB Protein ID BMDBP01400
Secondary Accession Numbers None
Name Regakine-1
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Involved in chemokine activity
Specific Function Chemotactic activity for neutrophils and lymphocytes. Binds to heparin.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus Not Available
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 92
Molecular Weight 10281.0
Theoretical pI 8.65
Pfam Domain Function Not Available
Signals
  • 1-21
Transmembrane Regions Not Available
Protein Sequence
>Regakine-1
MRVSLAALAFLLTLAVLHSEANEEPAGNMRVCCFSSVTRKIPLSLVKNYERTGDKCPQEA
VIFQTRSGRSICANPGQAWVQKYIEYLDQMSK
GenBank ID Protein CAC85743.1
UniProtKB/Swiss-Prot ID P82943
UniProtKB/Swiss-Prot Entry Name REG1_BOVIN
PDB IDs Not Available
GenBank Gene ID AJ313203
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available