Showing Protein Platelet factor 4 (BMDBP01408)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01408 |
| Secondary Accession Numbers | None |
| Name | Platelet factor 4 |
| Synonyms | Not Available |
| Gene Name | PF4 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in chemokine activity |
| Specific Function | Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 6 |
| Locus | Not Available |
| SNPs | PF4 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 88 |
| Molecular Weight | 9523.0 |
| Theoretical pI | 6.49 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Platelet factor 4 ESSFPATFVPLPADSEGGEDEDLQCVCLKTTSGINPRHISSLEVIGAGTHCPSPQLLATK KTGRKICLDQQRPLYKKILKKLLDGDES |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | P02777 |
| UniProtKB/Swiss-Prot Entry Name | PLF4_BOVIN |
| PDB IDs | |
| GenBank Gene ID | Not Available |
| GeneCard ID | PF4 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |