Showing Protein Neuroglobin (BMDBP01447)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01447 |
| Secondary Accession Numbers | None |
| Name | Neuroglobin |
| Synonyms | Not Available |
| Gene Name | NGB |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Involved in oxygen transport in the brain. Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of penetrating cell membranes (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 10 |
| Locus | Not Available |
| SNPs | NGB |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 151 |
| Molecular Weight | 16904.0 |
| Theoretical pI | 4.8 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Neuroglobin MELPEPELIRQSWREVSRSPLEHGTVLFARLFDLEPDLLPLFQYNCRQFSSPEDCLSSPE FLDHIRKVMLVIDAAVTNVEDLSSLEEYLAGLGRKHRAVGVKLSSFSTVGESLLYMLEKC LGPAFTPATRAAWSQLYGAVVQAMSRGWGGE |
| External Links | |
| GenBank ID Protein | CAG25616.2 |
| UniProtKB/Swiss-Prot ID | Q6WZ19 |
| UniProtKB/Swiss-Prot Entry Name | NGB_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AJ635234 |
| GeneCard ID | NGB |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |