Showing Protein Cytochrome P450 1B1 (BMDBP01463)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01463 |
| Secondary Accession Numbers | None |
| Name | Cytochrome P450 1B1 |
| Synonyms | Not Available |
| Gene Name | CYP1B1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Secondary metabolites biosynthesis, transport and catabolism |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 11 |
| Locus | Not Available |
| SNPs | CYP1B1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 115 |
| Molecular Weight | 13215.0 |
| Theoretical pI | 7.41 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Cytochrome P450 1B1 VNQWSVNHDPVKWSNPEDFDPTRFLDKDGLINKDLTGSVMAFSVGKRRCIGEEISKMQLF LFISILAHQCNFKANPDEPSKMDFNYGLTIKPKSFKINVTLRESMELLDSAVQKY |
| External Links | |
| GenBank ID Protein | BAF95890.1 |
| UniProtKB/Swiss-Prot ID | A9CSR6 |
| UniProtKB/Swiss-Prot Entry Name | A9CSR6_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AB373012 |
| GeneCard ID | CYP1B1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |