Showing Protein Hemoglobin subunit beta (BMDBP01492)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01492 |
| Secondary Accession Numbers | None |
| Name | Hemoglobin subunit beta |
| Synonyms | Not Available |
| Gene Name | HBB |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in heme binding |
| Specific Function | Involved in oxygen transport from the lung to the various peripheral tissues. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 15 |
| Locus | 15q22-q27 |
| SNPs | HBB |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 145 |
| Molecular Weight | 15954.0 |
| Theoretical pI | 7.77 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Hemoglobin subunit beta MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTADAVMNNPKVK AHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPENFKLLGNVLVVVLARNFGKE FTPVLQADFQKVVAGVANALAHRYH |
| External Links | |
| GenBank ID Protein | CAA25111.1 |
| UniProtKB/Swiss-Prot ID | P02070 |
| UniProtKB/Swiss-Prot Entry Name | HBB_BOVIN |
| PDB IDs | |
| GenBank Gene ID | X00376 |
| GeneCard ID | HBB |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |