Showing Protein Cytochrome b (BMDBP01504)
Identification | |
---|---|
BMDB Protein ID | BMDBP01504 |
Secondary Accession Numbers | None |
Name | Cytochrome b |
Synonyms | Not Available |
Gene Name | cytb |
Protein Type | Enzyme |
Biological Properties | |
General Function | Energy production and conversion |
Specific Function | Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | Not Available |
Locus | Not Available |
SNPs | cytb |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 379 |
Molecular Weight | 42591.0 |
Theoretical pI | 8.02 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>Cytochrome b MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTT TAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILL LTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFA FHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALM LLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILI LALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASILYFL LILVLMPTAGTVENKLLKW |
External Links | |
GenBank ID Protein | AAW78524.1 |
UniProtKB/Swiss-Prot ID | Q5EG37 |
UniProtKB/Swiss-Prot Entry Name | Q5EG37_BOVIN |
PDB IDs | |
GenBank Gene ID | AY885285 |
GeneCard ID | cytb |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |