Showing Protein Cytochrome c-1 (BMDBP01527)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01527 |
| Secondary Accession Numbers | None |
| Name | Cytochrome c-1 |
| Synonyms | Not Available |
| Gene Name | CYC1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 14 |
| Locus | Not Available |
| SNPs | CYC1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 182 |
| Molecular Weight | 20421.0 |
| Theoretical pI | 4.9 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Cytochrome c-1 IRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPG KLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLRE GLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMG LK |
| External Links | |
| GenBank ID Protein | CAD58788.1 |
| UniProtKB/Swiss-Prot ID | Q7YRA7 |
| UniProtKB/Swiss-Prot Entry Name | Q7YRA7_BOVIN |
| PDB IDs | |
| GenBank Gene ID | AJ518951 |
| GeneCard ID | CYC1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |