Identification
BMDB Protein ID BMDBP01557
Secondary Accession Numbers None
Name Cytochrome P450 family 4 subfamily A
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus Not Available
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 186
Molecular Weight 20806.0
Theoretical pI 6.42
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 30-56
  • 77-98
  • 113-133
  • 140-158
  • 178-200
  • 229-246
  • 288-307
  • 319-338
  • 350-372
Protein Sequence
>Cytochrome P450 family 4 subfamily A
LSDEDLRAEVDTFMFEGHDTTASGISWILYALASHPEHQQRCREEIQSLLADGASITWDH
LDQMPYTTMRIKEAMRLYPPVPVISRELSKPITFPDGHSLPAGILVSLSIYGLHHNPKVW
PNPEVFDPTRFAPGSTRHSHAFLPFSGGSRNCIGKQFAMNELKVAVALTLLRFELSPDSS
RVPVPM
GenBank ID Protein AAZ09199.1
UniProtKB/Swiss-Prot ID Q4F8H2
UniProtKB/Swiss-Prot Entry Name Q4F8H2_BOVIN
PDB IDs Not Available
GenBank Gene ID DQ100360
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available