Showing Protein Calcium-binding protein 1 (BMDBP01597)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01597 |
| Secondary Accession Numbers | None |
| Name | Calcium-binding protein 1 |
| Synonyms | Not Available |
| Gene Name | CABP1 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in calcium ion binding |
| Specific Function | Modulates calcium-dependent activity of inositol 1,4,5-triphosphate receptors (ITPRs). Inhibits agonist-induced intracellular calcium signaling. Enhances inactivation and does not support calcium-dependent facilitation of voltage-dependent P/Q-type calcium channels. Causes calcium-dependent facilitation and inhibits inactivation of L-type calcium channels by binding to the same sites as calmodulin in the C-terminal domain of CACNA1C, but has an opposite effect on channel function. Suppresses the calcium-dependent inactivation of CACNA1D. Inhibits TRPC5 channels. Prevents NMDA receptor-induced cellular degeneration. Required for the normal transfer of light signals through the retina. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 17 |
| Locus | Not Available |
| SNPs | CABP1 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 226 |
| Molecular Weight | 25755.0 |
| Theoretical pI | 4.49 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Calcium-binding protein 1 MGNCVKSPLRNLSRKMRQEETSYTVVQTSEEGLAASGELPGPLLMLAQNCAVMHNLLGPA CIFLRKGFAENRQPDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEM ELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEIST SELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR |
| External Links | |
| GenBank ID Protein | AAF25785.1 |
| UniProtKB/Swiss-Prot ID | Q9N1R0 |
| UniProtKB/Swiss-Prot Entry Name | CABP1_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AF169151 |
| GeneCard ID | CABP1 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |