Showing Protein Prostaglandin E2 receptor EP3 subtype (BMDBP01610)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01610 |
| Secondary Accession Numbers | None |
| Name | Prostaglandin E2 receptor EP3 subtype |
| Synonyms | Not Available |
| Gene Name | PTGER3 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Not Available |
| Specific Function | Receptor for prostaglandin E2 (PGE2) (PubMed:8396726). The various isoforms have identical ligand binding properties but interact with different second messenger systems: isoform EP3A couples to G(i)/G(o) proteins; isoform EP3B and isoform EP3C couple to G(s), and isoform EP3D couples to G(i), G(s) and G(p) (PubMed:8396726). Required for normal development of fever in response to pyrinogens, including IL1B, prostaglandin E2 and bacterial lipopolysaccharide (LPS). Required for normal potentiation of platelet aggregation by prostaglandin E2, and thus plays a role in the regulation of blood coagulation. Required for increased HCO3(-) secretion in the duodenum in response to mucosal acidification, and thereby contributes to the protection of the mucosa against acid-induced ulceration. Not required for normal kidney function, normal urine volume and osmolality (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 3 |
| Locus | Not Available |
| SNPs | PTGER3 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 417 |
| Molecular Weight | 46362.0 |
| Theoretical pI | 9.17 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Prostaglandin E2 receptor EP3 subtype MKATRDHASAPFCTRFNHSDPGIWAAERAVEAPNNLTLPPEPSEDCGSVSVAFSMTMMIT GFVGNALAITLVSKSYRRREGKRKKSFLLCIGWLALTDMVGQLLTSPVVIVLYLSHQRWE QLDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALATRAPHWYSSHMKTSVTRAVLLGV WLAVLAFALLPVLGVGQYTIQWPGTWCFISTGPGGNGTNSRQNWGNVFFASAFAILGLSA LVVTFACNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIM MLKMIFNHTSVEHCKTYTENQDECNFFLIAVRLASLNQILDPWVYLLLRKILLQKFCQLL KGHSYGLDTEGGTENKDKEMKENLYISNLSRFFILLGHFTEARRGRGHIYLHTLEHQ |
| External Links | |
| GenBank ID Protein | BAA04811.1 |
| UniProtKB/Swiss-Prot ID | P34979 |
| UniProtKB/Swiss-Prot Entry Name | PE2R3_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | D21345 |
| GeneCard ID | PTGER3 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |