You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01613
Secondary Accession Numbers None
Name Prostaglandin E2 receptor EP4
Synonyms Not Available
Gene Name ep4
Protein Type Enzyme
Biological Properties
General Function Involved in prostaglandin E receptor activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 20
Locus Not Available
SNPs ep4
Gene Sequence Not Available
Protein Properties
Number of Residues 168
Molecular Weight 18505.0
Theoretical pI 8.04
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 12-33
  • 53-71
  • 91-112
  • 142-167
Protein Sequence
>Prostaglandin E2 receptor EP4
SRKEQKETTFYTLVCGLAVTDLLGTLLVSPVTIATYLKGQWPGGHALCEYSTFILLFFGL
SGLSIICAMSIERYLAINHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPSMGLGSSRLQ
YPATWCFIDWTTNVTAHAAFSYMYAGFSSFLILATVLCNVLVCGALLR
GenBank ID Protein CAC44530.1
UniProtKB/Swiss-Prot ID Q95M50
UniProtKB/Swiss-Prot Entry Name Q95M50_BOVIN
PDB IDs Not Available
GenBank Gene ID AJ295565
GeneCard ID ep4
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available