You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein Prostaglandin E2 receptor EP4 (BMDBP01613)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01613 |
| Secondary Accession Numbers | None |
| Name | Prostaglandin E2 receptor EP4 |
| Synonyms | Not Available |
| Gene Name | ep4 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in prostaglandin E receptor activity |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 20 |
| Locus | Not Available |
| SNPs | ep4 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 168 |
| Molecular Weight | 18505.0 |
| Theoretical pI | 8.04 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Prostaglandin E2 receptor EP4 SRKEQKETTFYTLVCGLAVTDLLGTLLVSPVTIATYLKGQWPGGHALCEYSTFILLFFGL SGLSIICAMSIERYLAINHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPSMGLGSSRLQ YPATWCFIDWTTNVTAHAAFSYMYAGFSSFLILATVLCNVLVCGALLR |
| External Links | |
| GenBank ID Protein | CAC44530.1 |
| UniProtKB/Swiss-Prot ID | Q95M50 |
| UniProtKB/Swiss-Prot Entry Name | Q95M50_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AJ295565 |
| GeneCard ID | ep4 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |