You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01614
Secondary Accession Numbers None
Name Prostaglandin E2 receptor EP2
Synonyms Not Available
Gene Name ep2
Protein Type Enzyme
Biological Properties
General Function Involved in prostaglandin E receptor activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus Not Available
SNPs ep2
Gene Sequence Not Available
Protein Properties
Number of Residues 133
Molecular Weight 15313.0
Theoretical pI 10.23
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 26-45
  • 71-95
Protein Sequence
>Prostaglandin E2 receptor EP2
AMALERYLAVGHPYFYQRRVTRRSGLAVLPTIYIVSLLFCSLPLLDHWKYAQYNPGTWCF
IGHKQTTYLRLYATLLLLLIIAVLACNFSVIVNLIHMHRRGRRSRCGPSLGSSHRRAERV
SMAEETDHLILLA
GenBank ID Protein CAC44529.1
UniProtKB/Swiss-Prot ID Q95M51
UniProtKB/Swiss-Prot Entry Name Q95M51_BOVIN
PDB IDs Not Available
GenBank Gene ID AJ295564
GeneCard ID ep2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available