You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Identification
BMDB Protein ID BMDBP01618
Secondary Accession Numbers None
Name Apolipoprotein C-III
Synonyms Not Available
Gene Name APOC3
Protein Type Enzyme
Biological Properties
General Function Involved in lipid binding
Specific Function Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 15
Locus Not Available
SNPs APOC3
Gene Sequence
>291 bp
ATGCAGCCCCGGCTGCTCCTTCTTGCTGCCTTCCTGGCGCTCCTGGTCTTGCCTGAAGCT
ACCAAGGCCGAGGAGGGATCCCTTCTGGACAAGATGCAGGGCTATGTGAAGGAGGCCACC
AAGACCGCCAAGGATGCCCTGAGCAGCGTTCAGGAGTCCCAGGTGGCCCAGCAGGCCAGA
GACTGGATGACTGAGAGCTTCAGCTCCCTGAAAGACTACTGGAGCTCGTTCAAGGGCAAG
TTCACTGACTTCTGGGAATCTGCCACCAGTCCCACACAGTCTCCACCCTGA
Protein Properties
Number of Residues 96
Molecular Weight 10692.0
Theoretical pI 4.74
Pfam Domain Function Not Available
Signals
  • 1-23
Transmembrane Regions
  • 30-56
  • 77-98
  • 113-133
  • 140-158
  • 178-200
  • 229-246
  • 288-307
  • 319-338
  • 350-372
Protein Sequence
>Apolipoprotein C-III
MQPRLLLLAAFLALLVLPEATKAEEGSLLDKMQGYVKEATKTAKDALSSVQESQVAQQAR
DWMTESFSSLKDYWSSFKGKFTDFWESATSPTQSPP
GenBank ID Protein BAD15291.1
UniProtKB/Swiss-Prot ID P19035
UniProtKB/Swiss-Prot Entry Name APOC3_BOVIN
PDB IDs Not Available
GenBank Gene ID AB126687
GeneCard ID APOC3
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available