You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein Apolipoprotein C-III (BMDBP01618)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01618 |
| Secondary Accession Numbers | None |
| Name | Apolipoprotein C-III |
| Synonyms | Not Available |
| Gene Name | APOC3 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in lipid binding |
| Specific Function | Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 15 |
| Locus | Not Available |
| SNPs | APOC3 |
| Gene Sequence |
>291 bp ATGCAGCCCCGGCTGCTCCTTCTTGCTGCCTTCCTGGCGCTCCTGGTCTTGCCTGAAGCT ACCAAGGCCGAGGAGGGATCCCTTCTGGACAAGATGCAGGGCTATGTGAAGGAGGCCACC AAGACCGCCAAGGATGCCCTGAGCAGCGTTCAGGAGTCCCAGGTGGCCCAGCAGGCCAGA GACTGGATGACTGAGAGCTTCAGCTCCCTGAAAGACTACTGGAGCTCGTTCAAGGGCAAG TTCACTGACTTCTGGGAATCTGCCACCAGTCCCACACAGTCTCCACCCTGA |
| Protein Properties | |
| Number of Residues | 96 |
| Molecular Weight | 10692.0 |
| Theoretical pI | 4.74 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Apolipoprotein C-III MQPRLLLLAAFLALLVLPEATKAEEGSLLDKMQGYVKEATKTAKDALSSVQESQVAQQAR DWMTESFSSLKDYWSSFKGKFTDFWESATSPTQSPP |
| External Links | |
| GenBank ID Protein | BAD15291.1 |
| UniProtKB/Swiss-Prot ID | P19035 |
| UniProtKB/Swiss-Prot Entry Name | APOC3_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AB126687 |
| GeneCard ID | APOC3 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |