Showing Protein Vasopressin V1b receptor (BMDBP01635)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01635 |
| Secondary Accession Numbers | None |
| Name | Vasopressin V1b receptor |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in vasopressin receptor activity |
| Specific Function | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 16 |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 209 |
| Molecular Weight | 23433.0 |
| Theoretical pI | 10.14 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Arginine vasopressin receptor V3 EITYRFRGPDRFCTAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPSRSTYPLI AAPWLLAAVLSLPQVFIFSIREVIQGSGVLDCWADFRFPWGPRAYITWTTLAIFILPVAM LTACYGLICHEICRNLKVKTEAGQAEGRSWGTGNRPSARGPVAAPRGLPSRVSSVSAISR AKIRTVKMTFVIVLAYIACWAPFFSVQMW |
| External Links | |
| GenBank ID Protein | AAL29302.1 |
| UniProtKB/Swiss-Prot ID | Q95L48 |
| UniProtKB/Swiss-Prot Entry Name | Q95L48_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AF420213 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |