Showing Protein Muscarinic acetylcholine receptor M4 (BMDBP01825)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01825 |
| Secondary Accession Numbers | None |
| Name | Muscarinic acetylcholine receptor M4 |
| Synonyms | Not Available |
| Gene Name | CHRM4 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Not Available |
| Specific Function | The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is inhibition of adenylate cyclase. May couple to multiple functional responses in cell lines. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 15 |
| Locus | Not Available |
| SNPs | CHRM4 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 126 |
| Molecular Weight | 13221.0 |
| Theoretical pI | 9.32 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Muscarinic acetylcholine receptor M4 MKQSVKKPPPPGDTTVRGELPNGKLEEAPPPVLPPPPRPMADKDTSNESSSGSATQNTKE RPPTELSTTEATTPATPAPPLQPRTLNPASKWSKIQIVTKQTGNECVTAIEIVPATPAGM RPAANV |
| External Links | |
| GenBank ID Protein | AAA30654.1 |
| UniProtKB/Swiss-Prot ID | P41986 |
| UniProtKB/Swiss-Prot Entry Name | ACM4_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | L27104 |
| GeneCard ID | CHRM4 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |