Showing Protein Melanocortin receptor 5 (BMDBP01827)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01827 |
| Secondary Accession Numbers | None |
| Name | Melanocortin receptor 5 |
| Synonyms | Not Available |
| Gene Name | MC5R |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in melanocortin receptor activity |
| Specific Function | Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. This receptor is a possible mediator of the immunomodulation properties of melanocortins (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 24 |
| Locus | Not Available |
| SNPs | MC5R |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 325 |
| Molecular Weight | 36526.0 |
| Theoretical pI | 8.32 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Melanocortin receptor 5 MNSSFHLHFLDLGLNTTDGNLSGLSVQNASSLCEDMGIAVEVFLALGLISLLENILVIGA IVRNRNLHTPMYFFVGSLAVADMLVSLSNSWETITIYLLTNKHLVMADASVRHLDNVFDS MICISVVASMCSLLAIAVDRYVTIFCALRYQRIMTGRRSGAIIGGIWAFCASCGTVFIVY YESTYVVICLIAMFLTMLLLMASLYTHMFLLARTHIRRIATLPGHSSVRQRTGVKGAITL AMLLGVFIVCWAPFFLHLILMISCPHNLYCSCFMSHFNMYLILIMCNSVIDPLIYAFRSQ EMRKTFKEIVCFQSFRTPCRFPSRY |
| External Links | |
| GenBank ID Protein | CAA05147.1 |
| UniProtKB/Swiss-Prot ID | P56451 |
| UniProtKB/Swiss-Prot Entry Name | MC5R_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AJ002024 |
| GeneCard ID | MC5R |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |