Showing Protein Oxytocin receptor (BMDBP01830)
Identification | |
---|---|
BMDB Protein ID | BMDBP01830 |
Secondary Accession Numbers | None |
Name | Oxytocin receptor |
Synonyms | Not Available |
Gene Name | Not Available |
Protein Type | Enzyme |
Biological Properties | |
General Function | Involved in oxytocin receptor activity |
Specific Function | Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. |
Pathways | Not Available |
Reactions | Not Available |
GO Classification | Not Available |
Cellular Location | Not Available |
Gene Properties | |
Chromosome Location | 22 |
Locus | Not Available |
SNPs | Not Available |
Gene Sequence | Not Available |
Protein Properties | |
Number of Residues | 309 |
Molecular Weight | 34166.0 |
Theoretical pI | 9.16 |
Pfam Domain Function | Not Available |
Signals |
|
Transmembrane Regions |
|
Protein Sequence |
>Oxytocin receptor MEGAFAANWSAEAVNGSAAPPGTEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLSRRTDRLAVLVTWLGCLVASAPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLATCYGLISFKIWQNLRLKTAAAAA EAAAGAEGEAADWAGRAILARVSNVKLISKAKIRTVKMTFIVVLAFIVCWTPFFFVQMWS VWDADAPKE |
External Links | |
GenBank ID Protein | AAC69889.1 |
UniProtKB/Swiss-Prot ID | Q71UE1 |
UniProtKB/Swiss-Prot Entry Name | Q71UE1_BOVIN |
PDB IDs | Not Available |
GenBank Gene ID | AF100633 |
GeneCard ID | Not Available |
GenAtlas ID | Not Available |
HGNC ID | Not Available |
References | |
General References | Not Available |