You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Bovine Metabolome Database.
Showing Protein DNA-binding protein inhibitor ID-3 (BMDBP01895)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01895 |
| Secondary Accession Numbers | None |
| Name | DNA-binding protein inhibitor ID-3 |
| Synonyms | Not Available |
| Gene Name | ID3 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in transcription regulator activity |
| Specific Function | Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Involved in myogenesis by inhibiting skeletal muscle and cardiac myocyte differentiation and promoting muscle precursor cells proliferation. Inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 2 |
| Locus | Not Available |
| SNPs | ID3 |
| Gene Sequence |
>360 bp ATGAAGGCGCTCAGCCCGGTTCGCGGCTGCTACGAGGCGGTATGCTGCCTGTCGGAACGC AGCCTGGCCATCGCGCGGGGCCGTGGCAAGAGCCCGGCCGCCGAGGAGCCGCTGAGCCTG CTTGACGACATGAACCACTGCTACTCGCGACTGAGGGAACTGGTACCCGGAGTCCCGCGA GGCACTCAGCTTAGCCAGGTGGAAATCCTGCAGCGCGTCATCGACTACATCCTCGACCTG CAGGTGGTCCTGGCCGAGCCGGCCCCTGGGCCCCCAGACGGCCCGCATCTTCCCATCCAG ACAGCTGAGCTCGCTCCGGAACTTGTGATCTCCAACGACCAAAGGAGCTTCTGCCACTGA |
| Protein Properties | |
| Number of Residues | 119 |
| Molecular Weight | 12999.0 |
| Theoretical pI | 5.13 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>DNA-binding protein inhibitor ID-3 MKALSPVRGCYEAVCCLSERSLAIARGRGKSPAAEEPLSLLDDMNHCYSRLRELVPGVPR GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDQRSFCH |
| External Links | |
| GenBank ID Protein | AAX09056.1 |
| UniProtKB/Swiss-Prot ID | Q5E981 |
| UniProtKB/Swiss-Prot Entry Name | ID3_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | BT021039 |
| GeneCard ID | ID3 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |