Showing Protein F-box only protein 6 (BMDBP01904)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01904 |
| Secondary Accession Numbers | None |
| Name | F-box only protein 6 |
| Synonyms | Not Available |
| Gene Name | FBXO6 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Not Available |
| Specific Function | Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complexes. Involved in endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranslocated into the cytosol and promoting their ubiquitination and subsequent degradation. Able to recognize and bind denatured glycoproteins, which are modified with not only high-mannose but also complex-type oligosaccharides. Also recognizes sulfated glycans. Also involved in DNA damage response by specifically recognizing activated CHEK1 (phosphorylated on 'Ser-345'), promoting its ubiquitination and degradation. Ubiquitination of CHEK1 is required to insure that activated CHEK1 does not accumulate as cells progress through S phase, or when replication forks encounter transient impediments during normal DNA replication (By similarity). |
| Pathways |
|
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 16 |
| Locus | Not Available |
| SNPs | FBXO6 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 265 |
| Molecular Weight | 30767.0 |
| Theoretical pI | Not Available |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>F-box only protein 6 MALVSINQLPENILLEVFMHVPARQLLRNCRPVCCLWRDLIDLVSLWKRKCLREGYVTED WDQPVSDWKVFYFLCSLRRNLLRNPCAEEDMKSWKIDSNGGDQWKVESLPGAHGTGFPDS KVKKYFVTSYDMCLKSQIIDLKAEGYWEELLDKFRPDIVVKDWFAPRADCGCTYQIRVQL ASADYLVLASFEPPPVTIHQWNDAKWTEVSHTFSDYPPGVRHIFFQHGGKDTQFWAGWYG PRVTNSSVVISHRVTRNPPHAMAQP |
| External Links | |
| GenBank ID Protein | ABQ12947.1 |
| UniProtKB/Swiss-Prot ID | Q3SX24 |
| UniProtKB/Swiss-Prot Entry Name | FBX6_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | BT030507 |
| GeneCard ID | FBXO6 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |